LRWD1 Antibody - Azide and BSA Free

Western Blot: LRWD1 Antibody [NBP3-03939] - Analysis of extracts of various cell lines, using LRWD1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

Product Discontinued

LRWD1 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human LRWD1 (NP_690852.1). QELDLSNNHLETLPDNLGLSHLRVLRCANNQLGDVTALCQFPKLEELSLEGNPFLTVNDNLKVSFLLPTLRKVNGKDASSTYSQVENLNRELTSRVTAHWE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRWD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:200-1:2000
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for LRWD1 Antibody - Azide and BSA Free

• DKFZp434K1815
• leucine-rich repeats and WD repeat domain containing 1
• ORCAleucine-rich repeat and WD repeat-containing protein 1
• ORC-associated protein
• origin recognition complex associated
• Origin recognition complex-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: LRWD1