LRRN1/NLRR-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRRN1/NLRR-1 Antibody [NBP1-83896] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: LRRN1/NLRR-1 Antibody [NBP1-83896] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRN1/NLRR-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSEQCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSSEGTLEISNIQIEDSGRYTCVAQNVQGAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRN1/NLRR-1 Protein (NBP1-83896PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRN1/NLRR-1 Antibody

  • fibronectin type III, immunoglobulin and leucine rich repeat domains 3
  • FIGLER3
  • KIAA1497
  • leucine rich repeat neuronal 1
  • leucine-rich repeat neuronal protein 1
  • LRN
  • LRRN1
  • Neuronal leucine-rich repeat protein 1
  • NLRR1
  • NLRR-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30614
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15412
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-84686
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-56176
Species: Hu
Applications: ICC/IF
NBP1-91810
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
AF3086
Species: Hu
Applications: WB, IHC
AF5495
Species: Mu
Applications: WB, IHC
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF-253-NA
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83896
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for LRRN1/NLRR-1 Antibody (NBP1-83896) (0)

There are no publications for LRRN1/NLRR-1 Antibody (NBP1-83896).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRN1/NLRR-1 Antibody (NBP1-83896) (0)

There are no reviews for LRRN1/NLRR-1 Antibody (NBP1-83896). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRRN1/NLRR-1 Antibody (NBP1-83896) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRN1/NLRR-1 Products

Bioinformatics Tool for LRRN1/NLRR-1 Antibody (NBP1-83896)

Discover related pathways, diseases and genes to LRRN1/NLRR-1 Antibody (NBP1-83896). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRN1/NLRR-1 Antibody (NBP1-83896)

Discover more about diseases related to LRRN1/NLRR-1 Antibody (NBP1-83896).
 

Pathways for LRRN1/NLRR-1 Antibody (NBP1-83896)

View related products by pathway.

PTMs for LRRN1/NLRR-1 Antibody (NBP1-83896)

Learn more about PTMs related to LRRN1/NLRR-1 Antibody (NBP1-83896).
 

Research Areas for LRRN1/NLRR-1 Antibody (NBP1-83896)

Find related products by research area.

Blogs on LRRN1/NLRR-1

There are no specific blogs for LRRN1/NLRR-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRN1/NLRR-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRN1
Entrez