LRRK2 Recombinant Protein Antigen

Images

 
There are currently no images for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LRRK2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LRRK2

Source: E.coli

Amino Acid Sequence: VVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LRRK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48524. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for LRRK2 Recombinant Protein Antigen

  • augmented in rheumatoid arthritis 17
  • AURA17
  • Dardarin
  • DKFZp434H2111
  • EC 2.7.11.1
  • FLJ45829
  • leucine-rich repeat kinase 2
  • leucine-rich repeat serine/threonine-protein kinase 2
  • LRRK2
  • PARK8
  • PARK8DARDARIN
  • Parkinson disease (autosomal dominant) 8
  • RIPK7
  • ROCO2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, In vitro
BC100-494
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PEP-ELISA, PAGE, KD, KO
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
H00002629-M01
Species: Hu, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF1438
Species: Hu
Applications: WB, IHC
NB600-1160
Species: Hu, Mu, Rt, Po, Bv, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-41486
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-75556
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47842
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
AF4736
Species: Hu
Applications: WB
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI

Publications for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP) (0)

There are no publications for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP) (0)

There are no reviews for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional LRRK2 Products

Bioinformatics Tool for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP)

Discover related pathways, diseases and genes to LRRK2 Recombinant Protein Antigen (NBP2-48524PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP)

Discover more about diseases related to LRRK2 Recombinant Protein Antigen (NBP2-48524PEP).
 

Pathways for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP)

View related products by pathway.

PTMs for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP)

Learn more about PTMs related to LRRK2 Recombinant Protein Antigen (NBP2-48524PEP).
 

Research Areas for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP)

Find related products by research area.

Blogs on LRRK2.

The role of Parkin and autophagy in retinal pigment epithelial cell (RPE) degradation
The root of Parkinson’s disease (PD) points to a poorly regulated electron transport chain leading to mitochondrial damage, where many proteins need to work cohesively to ensure proper function.  The two key players of this pathway are PINK1,...  Read full blog post.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Parkinson's Disease Infographic
Parkinson's disease affects the nervous system which controls movement. Damage to the levels of dopamine in the brain impairs the ability to relay messages to parts of the body which control movement. While the exact cause of the disease is unknown, r...  Read full blog post.

Novus Antibodies Highlighted in Parkinson's Disease Research
Identified almost two centuries ago, Parkinson's disease is a neurodegenerative disorder that afflicts an estimated 4-6 million worldwide (www.parkinsons.org). The prevalence of Parkinson's disease is expected to grow considerably as the average age o...  Read full blog post.

Customers Who Bought This Also Bought

PINK1 Antibody
BC100-494
LRRK2 Antibody
NB300-268

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LRRK2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRK2