LRRK2 Recombinant Protein Antigen

Images

 
There are currently no images for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LRRK2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LRRK2.

Source: E. coli

Amino Acid Sequence: VVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LRRK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48524.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LRRK2 Recombinant Protein Antigen

  • augmented in rheumatoid arthritis 17
  • AURA17
  • Dardarin
  • DKFZp434H2111
  • EC 2.7.11.1
  • FLJ45829
  • leucine-rich repeat kinase 2
  • leucine-rich repeat serine/threonine-protein kinase 2
  • LRRK2
  • PARK8
  • PARK8DARDARIN
  • Parkinson disease (autosomal dominant) 8
  • RIPK7
  • ROCO2

Background

LRRK2 is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain. The protein is present largely in the cytoplasm but also associates with the mitochondrial outer membrane. Mutations in this gene have been associated with Parkinson disease-8.

LRRK2 antibodies are useful tools for neurodegeneration research and certian kinase signaling pathway studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, S-ELISA, WB
NB300-270
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, In vitro, Simple Western, WB
BC100-494
Species: Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB600-1160
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB110-41486
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP2-17173
Species: Hu
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF4736
Species: Hu
Applications: WB
NBP2-32875
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
NBP3-47176
Species: Hu, Mu
Applications: ELISA, IHC, WB

Publications for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP) (0)

There are no publications for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP) (0)

There are no reviews for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LRRK2 Products

Research Areas for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP)

Find related products by research area.

Blogs on LRRK2.

The role of Parkin and autophagy in retinal pigment epithelial cell (RPE) degradation
The root of Parkinson’s disease (PD) points to a poorly regulated electron transport chain leading to mitochondrial damage, where many proteins need to work cohesively to ensure proper function.  The two key players of this pathway are PINK1, ...  Read full blog post.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Parkinson's Disease Infographic
Parkinson's disease affects the nervous system which controls movement. Damage to the levels of dopamine in the brain impairs the ability to relay messages to parts of the body which control movement. While the exact cause of the disease is unknown, r...  Read full blog post.

Novus Antibodies Highlighted in Parkinson's Disease Research
Identified almost two centuries ago, Parkinson's disease is a neurodegenerative disorder that afflicts an estimated 4-6 million worldwide (www.parkinsons.org). The prevalence of Parkinson's disease is expected to grow considerably as the average age o...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LRRK2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRK2