Home » LRRK2 » LRRK2 Proteins » LRRK2 Recombinant Protein Antigen

LRRK2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

LRRK2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LRRK2

Source: E.coli

Amino Acid Sequence: VVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLL
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LRRK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48524. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for LRRK2 Recombinant Protein Antigen

  • augmented in rheumatoid arthritis 17
  • AURA17
  • Dardarin
  • DKFZp434H2111
  • EC 2.7.11.1
  • FLJ45829
  • leucine-rich repeat kinase 2
  • leucine-rich repeat serine/threonine-protein kinase 2
  • LRRK2
  • PARK8
  • PARK8DARDARIN
  • Parkinson disease (autosomal dominant) 8
  • RIPK7
  • ROCO2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

alpha-Synuclein
Antibody
NBP2-15365
Immunohistochemistry-Frozen: alpha-Synuclein Antibody [NBP2-15365] - Frozen-sectioned adult mouse hippocampus. Green: alpha Synuclein protein stained by alpha Synuclein antibody diluted at 1:250. Red: NeuN, stained by NeuN antibody [2Q158] diluted at 1:500.
Western Blot: alpha-Synuclein Antibody [NBP2-15365] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membranes were blotted with alpha Synuclein antibody diluted at 1:2000 and competitor's antibody diluted at 1:2000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Frozen: alpha-Synuclein Antibody [NBP2-15365] - Frozen-sectioned adult mouse cerebellum. Green: alpha Synuclein protein stained by alpha Synuclein antibody diluted at 1:250. Red: beta Tubulin 3/ TUJ1, stained by beta Tubulin 3/ TUJ1 antibody [11710] (NBP2-43559 diluted at 1:500. Blue: Fluoroshield with DAPI.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Park7/DJ-1 Antibody
NB300-270
Simple Western: Park7/DJ-1 Antibody [NB300-270] - Simple Western lane view shows a specific band for Park7 (DJ-1) in 0.05 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: Park7/DJ-1 Antibody [NB300-270] - Lysates of the human RPE cell lines ARPE-19 (lane 1) and D407 (lane 2), the mouse RPE cell line B6-RPE07 (lane 3), mouse primary RPE (lane 4) and mouse brain lysates (lane 5) were harvested and analyzed by immunoblot assay with DJ-1 antibody. The DJ-1 signal varied in intensity in each RPE cell culture. Each lane contained 20 ug of protein. Protein loads were confirmed in replicate blots probed with GAPDH. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0067983), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Park7/DJ-1 Antibody [NB300-270] - Representative confocal micrographs of ARPE-19 monolayers plated on Transwells(R) and labeled with antibodies to DJ-1 (G,J) and COX IV (H,K). Under baseline conditions, there is very little colocalization between DJ-1 and COX IV, as observed in overlaid images (I); DJ-1 is mostly distributed through the cytoplasm (arrows). Upon oxidative stress induced by incubation with 400 uM H2O2 for 1 hr, DJ-1 staining is increased (arrowheads) in ARPE-19 (J) cultures. In cultures treated with H2O2 some DJ-1 re-distributed to mitochondria (arrowheads) and displayed significant colocalization with COX IV in overlaid images (L). Scale bar = 10 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0067983), licensed under a CC-BY licence.
(3 Reviews)
(20 Publications)
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, In vitro
PINK1 Antibody
BC100-494
Knockdown Validated: PINK1 Antibody [BC100-494] - HEK293 cells were co-transfected with PINK1 siRNA (#1 or #2) or scrambled siRNA (scrambled) and untagged wild-type (WT) or Ser65Ala (S65A) mutant Parkin as indicated using TransFectin reagent (Bio-Rad). 48 hrs post-transfection, cells were treated with/without 10 uM CCCP for 3 h. 0.25 mg of 1% Triton whole-cell lysate were subjected to immunoprecipitation with GST-Parkin antibody (S966C) covalently coupled to protein G Sepharose and then immunoblotted with anti-phospho-Ser65 antibody in the presence of dephosphorylated peptide. 5% of the IP was immunoblotted with total anti-Parkin antibody. 0.25 mg of whole-cell lysates were immunoprecipitated with anti-PINK1 antibody (S085D) and immunoblotted with anti-PINK1 antibody. Representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://rsob.royalsocietypublishing.org/cgi/doi/10.1098/rsob.120080) licensed under a CC-BY licence.
Western Blot: PINK1 Antibody [BC100-494] - Pathogenic mutants of Parkin are subjected to Ser65 phosphorylation. Phos-tag Western blotting for Parkin and Western blotting for PINK1 were performed using Parkin WT and a series of pathogenic mutants. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep01002) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: PINK1 Antibody [BC100-494] - Immunocytochemistry of PINK1 antibody (BC100-494 Lot G). HeLa cells were treated with valinomycin (1 uM for 24h) prior to being fixed in 10% buffered formalin for 10 min and permeabilized in 0.1% Triton X-100 in PBS for 10 min. Cells were incubated with BC100-494 at 20 ug/mL for 1h at room temperature, washed 3x in PBS and incubated with Alexa Fluor488 anti-rabbit secondary antibody. PINK1 (Green) was detected at the mitochondria. Tubulin (Red) was detected using an anti-tubulin antibody with an anti-mouse DyLight 550 secondary antibody. DNA (Blue) was counterstained with DAPI. Note: mitochondria staining might not be easily observed without treatment with valinomycin or CCCP.
(12 Reviews)
(181 Publications)
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PEP-ELISA, PAGE, KD, KO
Tau [p Thr181]
Antibody
NB100-82245
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - PPP2R2C level regulates Tau phosphatase levels. Representative image of immunoblots of indicated antibodies are shown in SHSY5Y cell lines after knockdown and overexpression PPP2R2C. Image collected and cropped by CiteAb from the following publication (www.aging-us.com/lookup/doi/10.18632/aging.103048) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Tau [p Thr181] Antibody [NB100-82245] - analysis of paraffin-embedded rat hippocampal region tissue from a model with Alzheimer's Disease using Tau (phospho-Thr181) antibody.
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD

Glucosylceramidase/GBA
H00002629-M01
Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Effect of Diltiazem on L444P and N370S/V394L GC Folding and Trafficking.Western blot analysis of untreated and diltiazem-treated L444P GC cells. L444P GC cells were cultured without or with diltiazem at varying concentrations for 7 d before the cells were lysed for SDS-PAGE and Western blot analysis. GC was detected using mouse anti-GC antibody 2E2. Beta-actin served as a loading control. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pbio.0060026) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml.
(1 Review)
(7 Publications)
Species: Hu, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Parkin Antibody
[Unconjugated]
AF1438
Parkin Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB, IHC
UCH-L1/PGP9.5
Antibody (31A3)
NB600-1160
Western Blot: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Western Blot Analysis of human brain tissue lysate using UCH-L1/PGP9.5 Antibody (31A3)
Immunocytochemistry/Immunofluorescence: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Immunofluorescence Analysis of T98G cells labeling Pgp9.5 with UCH-L1/PGP9.5 Antibody (31A3) followed by Goat anti-Mouse IgG-CF488 (Green). The nuclear counterstain is Nucspot (Red)
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Formalin-fixed, paraffin-embedded human brain stained with UchL1 antibody (PGP9.5) (1:500), peroxidase-conjugate and DAB chromogen. Staining seen in cytoplasm, ER and membrane. Fixation in 95% ethanol/5% acetic acid for 2-3 hours prior to paraffin embedding is recommended. Specimens which have not been fixed in acetic acid/alcohol require pre-treatment with citrate buffer: for example, unmask of the target epitope by boiling the tissue sections in 10mM citrate buffer, pH 6.0, for 10 min followed by cooling at room temp for 20 min.
(1 Review)
(13 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
ATP13A2 Antibody
NB110-41486
Western Blot: ATP13A2 Antibody [NB110-41486] - Detection of ATP13A2 in mouse brain membrane lysate.
Immunohistochemistry: ATP13A2 Antibody [NB110-41486] - Staining of neurons and neuropils using a concentration of 10ug/ml. Human brain, 40X.
Simple Western: ATP13A2 Antibody [NB110-41486] - Simple Western lane view shows a specific band for ATP13A2 in 0.5 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(2 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, IHC
LRRK1 Antibody
(5B1)
NBP2-75556
Western Blot: LRRK1 Antibody (5B1) [NBP2-75556] - Analysis of LRRK1 on A549 lysate using anti-LRRK1 antibody at 1/100 dilution.
Immunohistochemistry-Paraffin: LRRK1 Antibody (5B1) [NBP2-75556] - Analysis of paraffin-embedded mouse kidney tissue using anti-LRRK1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: LRRK1 Antibody (5B1) [NBP2-75556] - Analysis of paraffin-embedded human kidney tissue using anti-LRRK1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
ERK2 Antibody
(OTI6E5)
NBP1-47842
Western Blot: ERK2 Antibody (6E5) [NBP1-47842] - Analysis of extracts (35ug) from 9 different cell lines by using anti-ERK2 monoclonal antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Western Blot: ERK2 Antibody (6E5) [NBP1-47842] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ERK2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ERK2.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
Bone marrow
stromal cell antigen ...
AF4736
Bone marrow stromal cell antigen 1/CD157 Antibody
(3 Publications)
Species: Hu
Applications: WB
Moesin Antibody
(MSN/491)
NBP2-32875
Western Blot: Moesin Antibody (MSN/491) [NBP2-32875] - Analysis using the Azide and BSA Free version of NBP2-32875. Detection of Moesin in human HT29 Cells.
Immunocytochemistry/Immunofluorescence: Moesin Antibody (MSN/491) [NBP2-32875] - Immunofluorescence Analysis of PFA-fixed HeLa cells labeling Moesin with Moesin Antibody (MSN/491) followed by Goat anti-Mouse IgG-CF488 (Green). The nuclear counterstain is Red Dot (Red)
Immunohistochemistry-Paraffin: Moesin Antibody (MSN/491) [NBP2-32875] - Fomalin-paraffin Rat colon stained with Moesin MAb (MSN/491)
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Tyrosine Hydroxylase Antibody [NB300-109] - Dopamine neurons in the mouse substantia nigra. ICC/IF image submitted by a verified customer review.
Simple Western: Tyrosine Hydroxylase Antibody [NB300-109] - Simple Western lane view shows a specific band for Tyrosine Hydroxylase in 0.2 mg/mL of PC-12 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(7 Reviews)
(143 Publications)
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
14-3-3 Antibody
NBP2-27202
Western Blot: 14-3-3 Antibody [NBP2-27202] - analysis of 14-3-3 using 14-3-3 antibody. Human Brain tissue lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain, and 4) rat brain lysate probed with 2 ug/ml of 14-3-3 antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: 14-3-3 Antibody [NBP2-27202] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-14-3-3 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Simple Western: 14-3-3 Antibody [NBP2-27202] - Simple Western lane view shows a specific band for 14-3-3 Gamma in 0.5 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(1 Review)
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF
MBP Antibody (12)
NB600-717
Western Blot: MBP Antibody (12) [NB600-717] - Mouse Brain Tissue lysate probed with Rat anti MBP.
Immunocytochemistry/Immunofluorescence: MBP Antibody (12) [NB600-717] - Histological and mRNA analysis of the inflammatory cytokines in the vehicle- or etifoxine-treated mice at onset of clinical symptoms. At day 10 p.i., drug treated animals showed significant differences in MBP staining. Animals treated with etifoxine showed an increase in retention of percentage of MBP coverage (*p = 0.001). Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/cgi/doi/10.1002/emmm.201202124), licensed under a CC-BY licence.
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse brain corpus callosum. Image from verified customer review.
(3 Reviews)
(19 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Recombinant Human
PGAP1 GST (N-Term) Pr ...
H00080055-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu

Publications for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP) (0)

There are no publications for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP) (0)

There are no reviews for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional LRRK2 Products

Bioinformatics Tool for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP)

Discover related pathways, diseases and genes to LRRK2 Recombinant Protein Antigen (NBP2-48524PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP)

Discover more about diseases related to LRRK2 Recombinant Protein Antigen (NBP2-48524PEP).
 

Pathways for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP)

View related products by pathway.

PTMs for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP)

Learn more about PTMs related to LRRK2 Recombinant Protein Antigen (NBP2-48524PEP).
 

Research Areas for LRRK2 Recombinant Protein Antigen (NBP2-48524PEP)

Find related products by research area.

Blogs on LRRK2.

Check out the latest blog posts on LRRK2.
The role of Parkin and autophagy in retinal pigment epithelial cell (RPE) degradation
The root of Parkinson’s disease (PD) points to a poorly regulated electron transport chain leading to mitochondrial damage, where many proteins need to work cohesively to ensure proper function.  The two key players of this pathway are PINK1,...  Read full blog post.
The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.
Parkinson's Disease Infographic
Parkinson's disease affects the nervous system which controls movement. Damage to the levels of dopamine in the brain impairs the ability to relay messages to parts of the body which control movement. While the exact cause of the disease is unknown, r...  Read full blog post.
Novus Antibodies Highlighted in Parkinson's Disease Research
Identified almost two centuries ago, Parkinson's disease is a neurodegenerative disorder that afflicts an estimated 4-6 million worldwide (www.parkinsons.org). The prevalence of Parkinson's disease is expected to grow considerably as the average age o...  Read full blog post.

Customers Who Bought This Also Bought

Knockdown Validated: PINK1 Antibody [BC100-494] - HEK293 cells were co-transfected with PINK1 siRNA (#1 or #2) or scrambled siRNA (scrambled) and untagged wild-type (WT) or Ser65Ala (S65A) mutant Parkin as indicated using TransFectin reagent (Bio-Rad). 48 hrs post-transfection, cells were treated with/without 10 uM CCCP for 3 h. 0.25 mg of 1% Triton whole-cell lysate were subjected to immunoprecipitation with GST-Parkin antibody (S966C) covalently coupled to protein G Sepharose and then immunoblotted with anti-phospho-Ser65 antibody in the presence of dephosphorylated peptide. 5% of the IP was immunoblotted with total anti-Parkin antibody. 0.25 mg of whole-cell lysates were immunoprecipitated with anti-PINK1 antibody (S085D) and immunoblotted with anti-PINK1 antibody. Representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://rsob.royalsocietypublishing.org/cgi/doi/10.1098/rsob.120080) licensed under a CC-BY licence.
PINK1 Antibody
BC100-494
Western Blot: LRRK2 Antibody [NB300-268] - Western blotting of LRRK2. Recombinant LRRK2 (arrowhead) from transfected (+) HEK 293T and M17 cells was specifically recognized by all four LRRK2 antibodies (Ab1, Ab2, Ab3, and Ab4) used in this study. LRRK2 was not recognized in non-transfected cells (-). Image collected and cropped by CiteAb from the following publication (http://molecularneurodegeneration.biomedcentral.com/articles/10.1186/1750-1326-1-17), licensed under a CC-BY licence.
LRRK2 Antibody
NB300-268
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Tyrosine Hydroxylase Antibody
NB300-109

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LRRK2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LRRK2