Recombinant Human LRRC41 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human LRRC41 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 86-195 of Human LRRC41

Source: Wheat Germ

Amino Acid Sequence: ERIEETALKKGLSTQAIWRRLWDELMKTRPSSLESVTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELVAEPNRRVLETLASSL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
LRRC41
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LRRC41 Protein

  • leucine rich repeat containing 41
  • leucine-rich repeat-containing protein 41
  • MGC126571
  • MGC126573
  • MUF1 protein (MUF1)
  • MUF1elongin BC-interacting leucine-rich repeat protein
  • Protein Muf1
  • RP4-636H5.2

Background

LRRC41 - leucine rich repeat containing 41

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-22970
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-58788
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-75643
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87040
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00022836-Q01
Species: Hu
NBP1-49873
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56637
Species: Hu, Mu
Applications: WB
NBP2-67835
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84162
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90068
Species: Hu
Applications: IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
H00010489-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for LRRC41 Partial Recombinant Protein (H00010489-Q01) (0)

There are no publications for LRRC41 Partial Recombinant Protein (H00010489-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC41 Partial Recombinant Protein (H00010489-Q01) (0)

There are no reviews for LRRC41 Partial Recombinant Protein (H00010489-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRRC41 Partial Recombinant Protein (H00010489-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for LRRC41 Partial Recombinant Protein (H00010489-Q01)

Discover related pathways, diseases and genes to LRRC41 Partial Recombinant Protein (H00010489-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC41 Partial Recombinant Protein (H00010489-Q01)

Discover more about diseases related to LRRC41 Partial Recombinant Protein (H00010489-Q01).
 

Pathways for LRRC41 Partial Recombinant Protein (H00010489-Q01)

View related products by pathway.

Blogs on LRRC41

There are no specific blogs for LRRC41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LRRC41 Antibody
NBP2-14200

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LRRC41 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC41