LRRC28 Antibody

Images

 
Western Blot: LRRC28 Antibody [NBP2-48706] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: LRRC28 Antibody [NBP2-48706] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & the Golgi apparatus.
Immunohistochemistry-Paraffin: LRRC28 Antibody [NBP2-48706] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC28 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NIHLKGLPSYLYNKVIGCSGCGAPIQVSEVKLLSFSSGQRTVFLPAEVKAIGTEHDHVLPLQELAMRGLYHTYHSLLKDLNFL
Specificity
Specificity of human LRRC28 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC28
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRC28 Recombinant Protein Antigen (NBP2-48706PEP)

Reactivity Notes

Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC28 Antibody

  • FLJ34269
  • FLJ45242
  • leucine rich repeat containing 28
  • leucine-rich repeat-containing protein 28
  • MGC24976

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008399-D01P
Species: Hu, Rt
Applications: WB
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP2-30382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82636
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75410
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP2-53095
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-81551
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-65892
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37250
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-80803
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85385
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-48706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LRRC28 Antibody (NBP2-48706) (0)

There are no publications for LRRC28 Antibody (NBP2-48706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC28 Antibody (NBP2-48706) (0)

There are no reviews for LRRC28 Antibody (NBP2-48706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LRRC28 Antibody (NBP2-48706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for LRRC28 Antibody (NBP2-48706)

Discover related pathways, diseases and genes to LRRC28 Antibody (NBP2-48706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC28 Antibody (NBP2-48706)

Discover more about diseases related to LRRC28 Antibody (NBP2-48706).
 

Pathways for LRRC28 Antibody (NBP2-48706)

View related products by pathway.

Blogs on LRRC28

There are no specific blogs for LRRC28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC28