LRRC28 Antibody

Western Blot: LRRC28 Antibody [NBP2-48706] - Analysis in control (vector only transfected HEK293T lysate) and LRRC28 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: LRRC28 Antibody [NBP2-48706] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & the Golgi apparatus.

Immunohistochemistry-Paraffin: LRRC28 Antibody [NBP2-48706] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Discontinued

LRRC28 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NIHLKGLPSYLYNKVIGCSGCGAPIQVSEVKLLSFSSGQRTVFLPAEVKAIGTEHDHVLPLQELAMRGLYHTYHSLLKDLNFL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRRC28
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LRRC28 Antibody

• FLJ34269
• FLJ45242
• leucine rich repeat containing 28
• leucine-rich repeat-containing protein 28
• MGC24976

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRRC28