ALDH6A1 Antibody - BSA Free

Western Blot: ALDH6A1 Antibody [NBP1-82636] - Analysis using Anti-ALDH6A1 antibody NBP1-82636 (A) shows similar pattern to independent antibody NBP1-82635 (B).

Immunocytochemistry/Immunofluorescence: ALDH6A1 Antibody [NBP1-82636] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82636] - Staining of human cerebral cortex.

Western Blot: ALDH6A1 Antibody [NBP1-82636] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82636] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82636] - Staining of human tonsil shows low expression as expected.

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82636] - Staining in human liver and tonsil tissues using anti-ALDH6A1 antibody. Corresponding ALDH6A1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82636] - Staining of human cerebral cortex, kidney, liver and testis using Anti-ALDH6A1 antibody NBP1-82636 (A) shows similar protein distribution across tissues to independent antibody NBP1-82637 (B).

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82636] - Staining of human testis.

Immunohistochemistry-Paraffin: ALDH6A1 Antibody [NBP1-82636] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ALDH6A1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNKAGEYIFERGSRHGKRVQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALDH6A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ALDH6A1 Protein (NBP1-82636PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ALDH6A1 Antibody - BSA Free

• aldehyde dehydrogenase 6 family, member A1
• Aldehyde dehydrogenase family 6 member A1
• EC 1.2.1.18
• EC 1.2.1.27
• Malonate-semialdehyde dehydrogenase [acylating]
• malonate-semialdehyde dehydrogenase
• methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
• MGC40271
• MMSADHA
• MMSDHmitochondrial acylating methylmalonate-semialdehyde dehydrogenase

Background

ALDH6A1 belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways. The product of this gene, a mitochondrial methylmalonate semialdehyde dehydrogenase, catalyzes the irreversible oxidative decarboxylation of malonate and methylmalonate semialdehydes to acetyl- and propionyl-CoA. Methylmalonate semialdehyde dehydrogenase deficiency is characterized by elevated beta-alanine, 3-hydroxypropionic acid, and both isomers of 3-amino and 3-hydroxyisobutyric acids in urine organic acids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALDH6A1