Recombinant Human LRP-1B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LRP-1B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 111-200 of Human LRP1B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VHCQELLSNCQQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECAVYGTCSQTCRNTHGSYTCSCVEGYLMQPDNRSCKAKIEPT

Protein/Peptide Type
Partial Recombinant Protein
Gene
LRP1B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LRP-1B Protein

  • EC 1.1.1.94
  • EC 3.4.21.9
  • low density lipoprotein receptor related protein-deleted in tumor
  • low density lipoprotein receptor-related protein 1B
  • low density lipoprotein-related protein 1B (deleted in tumors)
  • Low-density lipoprotein receptor-related protein-deleted in tumor
  • LRP1B
  • LRP-1B
  • LRP-deleted in tumors
  • LRPDIT
  • LRP-DIT
  • LRP-DITlow-density lipoprotein receptor-related protein 1B

Background

LRP1B - low density lipoprotein-related protein 1B (deleted in tumors)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00010438-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5699
Species: Hu, Mu
Applications: WB, IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
AF5948
Species: Hu, Rt
Applications: WB, IHC
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2216
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, PAGE
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-78162
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
H00053353-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for LRP-1B Partial Recombinant Protein (H00053353-Q01) (0)

There are no publications for LRP-1B Partial Recombinant Protein (H00053353-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRP-1B Partial Recombinant Protein (H00053353-Q01) (0)

There are no reviews for LRP-1B Partial Recombinant Protein (H00053353-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRP-1B Partial Recombinant Protein (H00053353-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LRP-1B Products

Bioinformatics Tool for LRP-1B Partial Recombinant Protein (H00053353-Q01)

Discover related pathways, diseases and genes to LRP-1B Partial Recombinant Protein (H00053353-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRP-1B Partial Recombinant Protein (H00053353-Q01)

Discover more about diseases related to LRP-1B Partial Recombinant Protein (H00053353-Q01).
 

Pathways for LRP-1B Partial Recombinant Protein (H00053353-Q01)

View related products by pathway.

PTMs for LRP-1B Partial Recombinant Protein (H00053353-Q01)

Learn more about PTMs related to LRP-1B Partial Recombinant Protein (H00053353-Q01).
 

Research Areas for LRP-1B Partial Recombinant Protein (H00053353-Q01)

Find related products by research area.

Blogs on LRP-1B

There are no specific blogs for LRP-1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LRP-1B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LRP1B
Entrez