LRFN5 Antibody


Western Blot: LRFN5 Antibody [NBP1-69704] - This Anti-LRFN5 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

LRFN5 Antibody Summary

Synthetic peptides corresponding to LRFN5(leucine rich repeat and fibronectin type III domain containing 5) The peptide sequence was selected from the middle region of LRFN5. Peptide sequence PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATR
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LRFN5 and was validated on Western blot.
Theoretical MW
79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LRFN5 Antibody

  • C14orf146
  • chromosome 14 open reading frame 146
  • DKFZp686G0210
  • fibronectin type III, immunoglobulin and leucine rich repeat domains 8
  • leucine rich repeat and fibronectin type III domain containing 5
  • leucine-rich repeat and fibronectin type-III domain-containing protein 5
  • LRFN5
  • SALM5
  • SALM5FLJ30803


The specific function of LRFN5 is not yet known.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt, Bv, Ca, Ha, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IM, IP
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for LRFN5 Antibody (NBP1-69704) (0)

There are no publications for LRFN5 Antibody (NBP1-69704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRFN5 Antibody (NBP1-69704) (0)

There are no reviews for LRFN5 Antibody (NBP1-69704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRFN5 Antibody (NBP1-69704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LRFN5 Products

Bioinformatics Tool for LRFN5 Antibody (NBP1-69704)

Discover related pathways, diseases and genes to LRFN5 Antibody (NBP1-69704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRFN5 Antibody (NBP1-69704)

Discover more about diseases related to LRFN5 Antibody (NBP1-69704).

Pathways for LRFN5 Antibody (NBP1-69704)

View related products by pathway.

PTMs for LRFN5 Antibody (NBP1-69704)

Learn more about PTMs related to LRFN5 Antibody (NBP1-69704).

Blogs on LRFN5

There are no specific blogs for LRFN5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LRFN5 Antibody and receive a gift card or discount.


Gene Symbol LRFN5