LRBA Recombinant Protein Antigen

Images

 
There are currently no images for LRBA Protein (NBP1-90765PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LRBA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LRBA.

Source: E.coli

Amino Acid Sequence: SVLMVSKYRDILEPQNERHSQSCTETGSENENVSLSEITPAAFSTLTTASVEESESTSSARRRDSGIGEETATGLGSHVEVTPHTAPPGVSAGPDAISEVLSTLSLEVNKSPETKNDRGNDLDTKATPSVSV

Protein/Peptide Type
Recombinant Protein Antigen
Gene
LRBA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90765.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LRBA Recombinant Protein Antigen

  • CDC4L
  • CDC4-like protein
  • DKFZp686A09128
  • DKFZp686K03100
  • FLJ16600
  • LAB300
  • LBA
  • lipopolysaccharide-responsive and beige-like anchor protein
  • LPS-responsive vesicle trafficking, beach and anchor containing
  • MGC72098
  • vesicle trafficking, beach and anchor containing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF6144
Species: Hu
Applications: WB, Simple Western
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-90765PEP
Species: Hu
Applications: AC

Publications for LRBA Protein (NBP1-90765PEP) (0)

There are no publications for LRBA Protein (NBP1-90765PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRBA Protein (NBP1-90765PEP) (0)

There are no reviews for LRBA Protein (NBP1-90765PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for LRBA Protein (NBP1-90765PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LRBA Products

LRBA NBP1-90765PEP

Bioinformatics Tool for LRBA Protein (NBP1-90765PEP)

Discover related pathways, diseases and genes to LRBA Protein (NBP1-90765PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRBA Protein (NBP1-90765PEP)

Discover more about diseases related to LRBA Protein (NBP1-90765PEP).
 

Pathways for LRBA Protein (NBP1-90765PEP)

View related products by pathway.

PTMs for LRBA Protein (NBP1-90765PEP)

Learn more about PTMs related to LRBA Protein (NBP1-90765PEP).

Blogs on LRBA

There are no specific blogs for LRBA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LRBA Antibody
NBP1-90764
LRBA Antibody
NBP1-90764
LRBA Antibody
NBP1-90764

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LRBA Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LRBA