Recombinant Human LRAT Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LRAT Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 33-132 of Human LRAT partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAYGANILVNHLDESLQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
LRAT

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LRAT Protein

  • EC 2.3.1.135
  • LCA14
  • lecithin retinol acyltransferase (phosphatidylcholine--retinolO-acyltransferase)
  • lecithin retinol acyltransferase
  • MGC33103
  • Phosphatidylcholine--retinol O-acyltransferase

Background

The protein encoded by this gene is a microsomal enzyme that catalyzes the esterification of all-trans-retinol into all-trans-retinyl ester, an essential reaction for the retinoid cycle in visual system and vitamin A status in liver. Mutations in this gene have been associated with early-onset severe retinal dystrophy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
NBP1-71701
Species: Hu, Mu
Applications: WB
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
H00064220-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74392
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-55057
Species: Hu
Applications: ICC/IF

Publications for LRAT Partial Recombinant Protein (H00009227-Q01) (0)

There are no publications for LRAT Partial Recombinant Protein (H00009227-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRAT Partial Recombinant Protein (H00009227-Q01) (0)

There are no reviews for LRAT Partial Recombinant Protein (H00009227-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRAT Partial Recombinant Protein (H00009227-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LRAT Products

Bioinformatics Tool for LRAT Partial Recombinant Protein (H00009227-Q01)

Discover related pathways, diseases and genes to LRAT Partial Recombinant Protein (H00009227-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRAT Partial Recombinant Protein (H00009227-Q01)

Discover more about diseases related to LRAT Partial Recombinant Protein (H00009227-Q01).
 

Pathways for LRAT Partial Recombinant Protein (H00009227-Q01)

View related products by pathway.

PTMs for LRAT Partial Recombinant Protein (H00009227-Q01)

Learn more about PTMs related to LRAT Partial Recombinant Protein (H00009227-Q01).

Blogs on LRAT

There are no specific blogs for LRAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LRAT Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LRAT