LPAR2/LPA2/EDG-4 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human LPAR2/LPA2/EDG-4. Peptide sequence: NSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIY The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LPAR2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for LPAR2/LPA2/EDG-4 Antibody - BSA Free
Background
Edg4 is a Lysophospholipid/Lysosphingolipid Receptor activated by phosphatidic acid (PA) and lysophosphatidic acid (LPA). It enhances the transcription of serum response element (SRE) reporter genes. In CD4(+) T cells, Edg4 may be involved in the control of interleukin-2 secretion. Edg4 expression has been documented in leukocytes, pancreas, spleen, thymus, prostate, and testis. Edg4 expression has also been seen in many cancer cell lines, including those of brain, blood, breast, ovary, cervix, colon, skin, and thyroid. ESTs have been isolated from B-cell/lung/testis, blood, brain, embryo, heart/melanocyte/uterus, liver, placenta, prostate, and skin libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Bt, Ha, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, IHC
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Publications for LPAR2/LPA2/EDG-4 Antibody (NBP2-87735) (0)
There are no publications for LPAR2/LPA2/EDG-4 Antibody (NBP2-87735).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LPAR2/LPA2/EDG-4 Antibody (NBP2-87735) (0)
There are no reviews for LPAR2/LPA2/EDG-4 Antibody (NBP2-87735).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LPAR2/LPA2/EDG-4 Antibody (NBP2-87735) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LPAR2/LPA2/EDG-4 Products
Research Areas for LPAR2/LPA2/EDG-4 Antibody (NBP2-87735)
Find related products by research area.
|
Blogs on LPAR2/LPA2/EDG-4