| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LOX. Source: E. coli Amino Acid Sequence: VGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRC Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | LOX |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55446. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for LOX Recombinant Protein Antigen (NBP2-55446PEP)Find related products by research area.
|
|
LOX: A prime enzyme LOX is a copper-dependent amine oxidase enzyme that executes post-translational oxidative deamination on peptidyl lysine residues in precursors of fibrous collagen and elastin. LOX is secreted into the extracellular environment in an inactive form, wh... Read full blog post. |
|
Understanding DNA Recombination with Cre-Lox Cyclization recombination enzyme (Cre) is a member of the extensive family of recombinases and recognizes a 34 bp sequence motif from PI bacteriophage referred to as LoxP. The Cre enzyme works to cleanly excise an intervening DNA fragment that is flan... Read full blog post. |
|
Cre/Lox: The Genomic Utility Knife Cre (Cyclization recombination enzyme) is a member of the large family of recombinases. Cre recognizes Lox site loxP, a 34 bp sequence motif from the PI bateriophage. If a DNA segment is flanked by two loxP sites in the same orientation, Cre neatly ex... Read full blog post. |
|
LOX propeptide: A novel peptide cancer therapeutic Lysyl oxidase, also known as LOX, is a copper-dependent enzyme that cross-links collagen and elastin through the oxidative deamination of peptidyl lysine (collagen and elastin) and hydroxylysine (collagen only) residues, thereby playing a critical rol... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LOX |