LOX Recombinant Protein Antigen

Images

 
There are currently no images for LOX Recombinant Protein Antigen (NBP2-55446PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LOX Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LOX.

Source: E. coli

Amino Acid Sequence: VGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LOX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55446.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LOX Recombinant Protein Antigen

  • AAT10
  • Lysyl Oxidase/LOX
  • lysyl oxidaseEC 1.4.3.13
  • MGC105112
  • protein-lysine 6-oxidase

Background

Lysyl oxidase (LOX), a copper-containing amine oxidase, belongs to a heterogeneous family of enzymes that oxidize primary amine substrates to reactive aldehydes. LOX plays a vital role in the formation and repair of the extracellular matrix. In addition, LOX is a multifunctional enzyme having diverse biological functions such as developmental regulation, tumor suppression, cell motility, and cellular senescence. The secreted form of LOX is responsible for the invasive properties of hypoxic human cancer cells. Thus, Lysyl oxidase is essential for hypoxia-induced metastasis and is a good therapeutic target for preventing and treating metastases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
NBP2-01740
Species: Ca, Hu, Pm, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00004016-D01P
Species: Hu, Mu
Applications: ICC/IF, IHC, Simple Western, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-35458
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC,  IHC-P, WB
NBP2-75964
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32954
Species: Fe, Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KO, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
AF1927
Species: Hu
Applications: IP, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-55446PEP
Species: Hu
Applications: AC

Publications for LOX Recombinant Protein Antigen (NBP2-55446PEP) (0)

There are no publications for LOX Recombinant Protein Antigen (NBP2-55446PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LOX Recombinant Protein Antigen (NBP2-55446PEP) (0)

There are no reviews for LOX Recombinant Protein Antigen (NBP2-55446PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LOX Recombinant Protein Antigen (NBP2-55446PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LOX Products

Research Areas for LOX Recombinant Protein Antigen (NBP2-55446PEP)

Find related products by research area.

Blogs on LOX.

LOX: A prime enzyme
LOX is a copper-dependent amine oxidase enzyme that executes post-translational oxidative deamination on peptidyl lysine residues in precursors of fibrous collagen and elastin. LOX is secreted into the extracellular environment in an inactive form, wh...  Read full blog post.

Understanding DNA Recombination with Cre-Lox
Cyclization recombination enzyme (Cre) is a member of the extensive family of recombinases and recognizes a 34 bp sequence motif from PI bacteriophage referred to as LoxP. The Cre enzyme works to cleanly excise an intervening DNA fragment that is flan...  Read full blog post.

Cre/Lox: The Genomic Utility Knife
Cre (Cyclization recombination enzyme) is a member of the large family of recombinases. Cre recognizes Lox site loxP, a 34 bp sequence motif from the PI bateriophage. If a DNA segment is flanked by two loxP sites in the same orientation, Cre neatly ex...  Read full blog post.

LOX propeptide: A novel peptide cancer therapeutic
Lysyl oxidase, also known as LOX, is a copper-dependent enzyme that cross-links collagen and elastin through the oxidative deamination of peptidyl lysine (collagen and elastin) and hydroxylysine (collagen only) residues, thereby playing a critical rol...  Read full blog post.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LOX Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LOX