Lnx1 Antibody (4E3)

Images

 
Sandwich ELISA: Lnx1 Antibody (4E3) [H00084708-M01] - Detection limit for recombinant GST tagged LNX1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lnx1 Antibody (4E3) Summary

Immunogen
LNX1 (NP_116011, 19 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DNVGNLHFLYSELCKGAFHYGLTKDRKRRSQDGCPDGCASLTATAPSPEVSAAATISLMTDEPGLDNPAYVSSAEDGQPAISPVDSGRSNRTRARPFERS
Specificity
LNX1 - ligand of numb-protein X 1 (4E3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LNX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lnx1 Antibody (4E3)

  • EC 6.3.2.-
  • ligand of numb-protein X 1ligand of numb-protein X
  • LNXmulti-PDZ-domain-containing protein, E3 ubiquitin-protein ligase LNX
  • MPDZ
  • Numb-binding protein 1
  • PDZ domain-containing ring finger protein 2
  • PDZRN2E3 ubiquitin-protein ligase LNX

Background

This gene encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene, which is located on chromosome 17, has been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-178
Species: Ch, Hu, Mu
Applications: ICC/IF, Simple Western, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-81441
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81069
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1354
Species: Hu
Applications: Flow, IF, PEP-ELISA
NBP1-88192
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-62606
Species: Hu
Applications: IHC, IHC-P
NB300-952
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NB100-88136
Species: Hu
Applications: IP, WB (-)
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47935
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
H00084708-M01
Species: Hu
Applications: WB, ELISA

Publications for Lnx1 Antibody (H00084708-M01) (0)

There are no publications for Lnx1 Antibody (H00084708-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lnx1 Antibody (H00084708-M01) (0)

There are no reviews for Lnx1 Antibody (H00084708-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lnx1 Antibody (H00084708-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lnx1 Antibody (4E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol LNX1
Entrez
Uniprot