New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

LMTK3 Antibody (5A10)

Images

 
Sandwich ELISA: LMTK3 Antibody (5A10) [H00114783-M06] - Detection limit for recombinant GST tagged LMTK3 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
5A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LMTK3 Antibody (5A10) Summary

Immunogen
LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG
Localization
Cell Membrane
Specificity
LMTK3 - lemur tyrosine kinase 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LMTK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMTK3 Antibody (5A10)

  • AATYK3
  • EC 2.7.11.1
  • lemur tyrosine kinase 3KIAA1883TYKLM3LMR3
  • serine/threonine-protein kinase LMTK3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
AF1016
Species: Hu
Applications: Neut, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF3206
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
AF641
Species: Mu
Applications: IHC, WB
NBP3-16473
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF1042
Species: Mu
Applications: IHC, WB
NBP1-43363
Species: Mu
Applications: B/N, Flow, IHC, IHC-Fr, IHC-P, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF321
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB8924
Species: Hu
Applications: CyTOF-ready, ICFlow
AF2000
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB4260
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB

Publications for LMTK3 Antibody (H00114783-M06) (0)

There are no publications for LMTK3 Antibody (H00114783-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMTK3 Antibody (H00114783-M06) (0)

There are no reviews for LMTK3 Antibody (H00114783-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMTK3 Antibody (H00114783-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMTK3 Products

Array H00114783-M06

Bioinformatics Tool for LMTK3 Antibody (H00114783-M06)

Discover related pathways, diseases and genes to LMTK3 Antibody (H00114783-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMTK3 Antibody (H00114783-M06)

Discover more about diseases related to LMTK3 Antibody (H00114783-M06).

PTMs for LMTK3 Antibody (H00114783-M06)

Learn more about PTMs related to LMTK3 Antibody (H00114783-M06).
 

Research Areas for LMTK3 Antibody (H00114783-M06)

Find related products by research area.

Blogs on LMTK3

There are no specific blogs for LMTK3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMTK3 Antibody (5A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol LMTK3
Entrez
Uniprot