Home » LMTK3 » LMTK3 Antibodies » LMTK3 Antibody (2H6)

LMTK3 Antibody (2H6)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: LMTK3 Antibody (2H6) [H00114783-M02] - LMTK3 monoclonal antibody (M02), clone 2H6 Analysis of LMTK3 expression in Hela S3 NE.
Western Blot: LMTK3 Antibody (2H6) [H00114783-M02] - LMTK3 monoclonal antibody (M02), clone 2H6 Analysis of LMTK3 expression in Hela S3 NE.
ELISA: LMTK3 Antibody (2H6) [H00114783-M02] - Detection limit for recombinant GST tagged LMTK3 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ChIP, ELISA, ICC/IF
Clone
2H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

LMTK3 Antibody (2H6) Summary

Immunogen
LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG
Localization
Cell Membrane
Specificity
LMTK3 - lemur tyrosine kinase 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LMTK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Chromatin Immunoprecipitation
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. Knock Out Validation was reported in scientific literature (PMID: 26212333).
Publications
Read Publication using H00114783-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMTK3 Antibody (2H6)

  • AATYK3
  • EC 2.7.11.1
  • lemur tyrosine kinase 3KIAA1883TYKLM3LMR3
  • serine/threonine-protein kinase LMTK3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
FOXO3 Antibody
NBP2-16521
Western Blot: FOXO3 Antibody [NBP2-16521] - FoxO3 expression in nuclear and cytosolic fraction of human breast cancer cell line MDA-MB-231. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: FOXO3 Antibody [NBP2-16521] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: FOXO3A stained by FOXO3A antibody [C3], C-term diluted at 1:1000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: FOXO3 Antibody [NBP2-16521] - C-term detects FOXO3A protein at cytoplasm and nucleus by immunohistochemical analysis.Sample: Paraffin-embedded mouse duodenum.FOXO3A stained by FOXO3A antibody [C3], C-term diluted at 1:2000.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
(4 Reviews)
(5 Publications)
Species: Hu, Mu, Rt, Sq, Xp
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
HRAS Antibody
(OTI1D9)
NBP2-45745
Western Blot: HRAS Antibody (OTI1D9) [NBP2-45745] - Analysis of extracts (35ug) from 9 different cell lines (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: HRAS Antibody (OTI1D9) [NBP2-45745] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: HRAS Antibody (OTI1D9) [NBP2-45745] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY vH RAS.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IF
Jak2 Antibody
(53B7)
NBP2-59451
Western Blot: Jak2 Antibody (53B7) [NBP2-59451] - Human breast cancer MCF7 cells were treated with control (Con) or Adenosine (Ado) and the expression of JAK2 was detected. Wester blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Jak2 Antibody (53B7) [NBP2-59451] - Analysis of JAK2 in HeLa cells line, stained with DAPI (Blue) and anti-human JAK2 antibody at 1:100 with goat anti-mouse IgG Alexa Fluor 488 conjugate (Green).
Flow Cytometry: Jak2 Antibody (53B7) [NBP2-59451] - Analysis of JAK2 in HeLa cell line, antibody at 2 - 5 ug per 10^6cells (red line). Secondary antibody: goat anti-mouse IgG Alexa Fluor 488 conjugate. Isotype control antibody: mouse IgG (black line).
(2 Reviews)
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, MiAr
Thrombopoietin
R/Tpo R Antibody
AF1016
Recombinant Human Thrombopoietin/Tpo (Catalog # 288-TP) stimulates proliferation in the MO7e human megakaryocytic leukemic cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Thrombopoietin/Tpo (10 ng/mL) is neutralized (green line) by increasing concen­trations of Goat Anti-Human Thrombopoietin R/Tpo R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1016). The ND50 is typically 0.5‑2.5 µg/mL.
(2 Publications)
Species: Hu
Applications: WB, Neut
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Lyn Antibody
[Unconjugated]
AF3206
Western blot shows lysates of U937 human histiocytic lymphoma cell line, PT18 mouse mast/basophil cell line, and Y3‑Ag rat myeloid cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Lyn at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, THP‑1 human acute monocytic leukemia cell line, Raji human Burkitt's lymphoma cell line, and Ramos human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Lyn at approximately 58-60 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Lyn was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) treated with monensin using Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
EphA4 Antibody
AF641
EphA4 was detected in immersion fixed frozen sections of embryonic rat rib cartilage primordium (E15) using 5 µg/mL Goat Anti-Mouse EphA4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF641) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(7 Publications)
Species: Mu
Applications: WB, IHC
Recombinant Human
NRAS Protein
NBP1-41158
SDS-Page: Recombinant Human NRAS Protein [NBP1-41158]
(1 Publication)
Species: Hu
PDGF R beta
Antibody [Unconjugate
AF1042
PDGF R beta was detected in immersion fixed frozen sections of mouse embryo spinal cord using 5 µg/mL Goat Anti-Mouse PDGF R beta Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1042) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of rat spinal cord tissue, rat brain tissue, and mouse brain tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse PDGF R beta Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1042) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for PDGF R beta at approximately 190 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(28 Publications)
Species: Mu
Applications: WB, IHC
M-CSFR/CD115
Antibody (AFS98)
NBP1-43363
Immunohistochemistry-Frozen: M-CSFR/CD115 Antibody (AFS98) [NBP1-43363] - Mouse brain section. Antibody at 1:200. IHC-Fr image submitted by a verified customer review.
Flow Cytometry: M-CSF R/CD115 Antibody (AFS98) [NBP1-43363] - Analysis using the Biotin conjugate of NBP1-43363. Staining of thioglycolate-induced peritoneal exudate cells with Anti-Mouse CD115 (c-fms) PE. Appropriate isotype controls were used (open histogram).
Flow Cytometry: M-CSF R/CD115 Antibody (AFS98) [NBP1-43363] - Staining of thioglycolate-induced peritoneal exudate cells with Anti-Mouse CD115 (c-fms) PE. Appropriate isotype controls were used (open histogram). Cells in the large scatter population were used for analysis.
(1 Review)
(2 Publications)
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, B/N
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Western Blot: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of PYK2 on mouse brain lysates using anti-PYK2 antibody at 1:1000 dilution.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of paraffin-embedded mouse kidney tissue using anti-PYK2 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
VEGFR1/Flt-1
Antibody [Unconjugate
AF321
VEGFR1/Flt‑1 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using 15 µg/mL Human VEGFR1/Flt‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF321) overnight at 4 °C. Tissue was stained (red) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
VEGFR1/Flt‑1 was detected in immersion fixed paraffin-embedded sections of human ovarian cancer tissue using Human VEGFR1/Flt‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF321) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(6 Reviews)
(32 Publications)
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready
PRRT2 Antibody
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
ROR alpha/NR1F1
Antibody
NBP1-52813
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - HepG2 cell lysate, concentration 1.25ug/ml.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF
ROR1 Antibody
[Unconjugated]
AF2000
Western blot shows lysate of NTera‑2 human testicular embryonic carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human ROR1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2000) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ROR1 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of NTera‑2 human testicular embryonic carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for ROR1 at approximately 143 kDa (as indicated) using 25 µg/mL of Goat Anti-Human ROR1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2000) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
MDA‑MB‑231 human breast cancer cell line was stained with Goat Anti-Human ROR1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2000, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
(2 Reviews)
(12 Publications)
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
Fyn Antibody
(FYN-01)
NB500-517
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in murine transformed fibroblasts using anti-Fyn (FYN-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human primary fibroblasts using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human HeLa cell line using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Jak1 Antibody
(413104) [Unconjugate
MAB4260
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, K562 human chronic myelogenous leukemia cell line, A20 mouse B cell lymphoma cell line, and L1.2 mouse pro‑B cell line. PVDF membrane was probed with 1 µg/mL of Rat Anti-Human/Mouse/Rat Jak1 Monoclonal Antibody (Catalog # MAB4260) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for Jak1 at approximately 130 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Jak1 was detected in immersion fixed paraffin-embedded sections of human epidermis using 25 µg/mL Rat Anti-Human/Mouse/Rat Jak1 Monoclonal Antibody (Catalog # MAB4260) overnight at 4 °C. Tissue was stained with the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Jurkat human acute T cell leukemia cell line was stained with Rat Anti-Human/Mouse/Rat Jak1 Monoclonal Antibody (Catalog # MAB4260, filled histogram) or isotype control antibody (Catalog # MAB0061, open histogram), followed by Phycoerythrin-conjugated Anti-Rat IgG F(ab')2 Secondary Antibody (Catalog # F0105B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow

Publications for LMTK3 Antibody (H00114783-M02)(1)


Reviews for LMTK3 Antibody (H00114783-M02) (0)

There are no reviews for LMTK3 Antibody (H00114783-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for LMTK3 Antibody (H00114783-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional LMTK3 Products

Array H00114783-M02

Bioinformatics Tool for LMTK3 Antibody (H00114783-M02)

Discover related pathways, diseases and genes to LMTK3 Antibody (H00114783-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMTK3 Antibody (H00114783-M02)

Discover more about diseases related to LMTK3 Antibody (H00114783-M02).

PTMs for LMTK3 Antibody (H00114783-M02)

Learn more about PTMs related to LMTK3 Antibody (H00114783-M02).
 

Research Areas for LMTK3 Antibody (H00114783-M02)

Find related products by research area.

Blogs on LMTK3

There are no specific blogs for LMTK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMTK3 Antibody (2H6) and receive a gift card or discount.


Bioinformatics

Gene Symbol LMTK3
Entrez
Uniprot