LMTK2 Recombinant Protein Antigen

Images

 
There are currently no images for LMTK2 Recombinant Protein Antigen (NBP2-58981PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LMTK2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LMTK2.

Source: E. coli

Amino Acid Sequence: MLTGDTLSTSLQSSPEVQVPPTSFETEETPRRVPPDSLPTQGETQPTCLDVIVPEDCLHQDISPDAVTVPVEILSTDARTHSLDNRSQDSPGESEETLRLTESDSVLADDILASRVSVGSSLPELGQELHNKPFSEDHH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LMTK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58981.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LMTK2 Recombinant Protein Antigen

  • AATK2
  • AATYK2FLJ46659
  • Apoptosis-associated tyrosine kinase 2
  • Brain-enriched kinase
  • BREK
  • BREKCDK5/p35-regulated kinase
  • CPRK
  • EC 2.7.11
  • KIAA1079hBREK
  • kinase phosphatase inhibitor 2
  • Kinase/phosphatase/inhibitor 2
  • KPI-2
  • KPI2EC 2.7.11.1
  • lemur tyrosine kinase 2Serine/threonine-protein kinase KPI-2
  • LMR2
  • LMR2cyclin-dependent kinase 5/p35-regulated kinase
  • LMTK2
  • serine/threonine-protein kinase LMTK2

Background

The protein encoded by the LMTK2 gene belongs to the protein kinase superfamily and the protein tyrosine kinase family. It contains N-terminal transmembrane helices and a long C-terminal cytoplasmic tail with serine/threonine/tyrosine kinase activity. This protein interacts with several other proteins, such as Inhibitor-2 (Inh2), protein phosphatase-1 (PP1C), p35, and myosin VI. It phosporylates other proteins, and is itself also phosporylated when interacting with cyclin-dependent kinase 5 (cdk5)/p35 complex. This protein involves in nerve growth factor (NGF)-TrkA signalling, and also plays a critical role in endosomal membrane trafficking. Mouse studies suggested an essential role of this protein in spermatogenesis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4866
Species: Hu
Applications: CyTOF-ready, ICFlow
H00004646-M02
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
2914-HT
Species: Hu
Applications: BA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
256-GF
Species: Hu
Applications: BA
DKK300
Species: Hu
Applications: ELISA
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89680
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-89530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF8064
Species: Hu
Applications: ICC, IHC, WB
NBP1-92564
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
2428-FC
Species: Hu
Applications: Bind
AF3770
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-91931
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
419-ML
Species: Mu
Applications: BA

Publications for LMTK2 Recombinant Protein Antigen (NBP2-58981PEP) (0)

There are no publications for LMTK2 Recombinant Protein Antigen (NBP2-58981PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMTK2 Recombinant Protein Antigen (NBP2-58981PEP) (0)

There are no reviews for LMTK2 Recombinant Protein Antigen (NBP2-58981PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LMTK2 Recombinant Protein Antigen (NBP2-58981PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LMTK2 Products

Array NBP2-58981PEP

Research Areas for LMTK2 Recombinant Protein Antigen (NBP2-58981PEP)

Find related products by research area.

Blogs on LMTK2

There are no specific blogs for LMTK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LMTK2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LMTK2