LKB1/STK11 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

LKB1/STK11 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LKB1/STK11.

  Source: E. coli

  Amino Acid Sequence: DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: STK11
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56895.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LKB1/STK11 Recombinant Protein Antigen

• EC 2.7.11.1
• LKB1 serine/threonine kinase 11 (Peutz-Jeghers syndrome)
• LKB1
• PJS polarization-related protein LKB1
• PJS
• Renal carcinoma antigen NY-REN-19
• serine/threonine kinase 11
• serine/threonine-protein kinase 11
• Serine/threonine-protein kinase LKB1
• STK11

Background

Peutz-Jeghers syndrome (PJS) is a rare hereditary disease characterized by melanocytic macules lips, gastrointestinal hamartomatous polyps and an increased risk for many classes of cancer. LKB1 (also designated STK11 and PJS) has been identified as the gene mutated in PJS. LKB1 is a 433 amino acid Serine/Threonine kinase with strong homology to the Xenopus cytoplasmic protein kinase XEEK1 and weaker similarity to many other protein kinases. LKB1 is ubiquitously expressed and many frameshift, deletion and splicing mutations have been identified in PJS patients. Despite the increased risk of cancer for PJS patients, LKB1 does not appear to play a major role in colorectal, testicular or breast cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: STK11