LIN7 Antibody

Images

 
Immunohistochemistry: LIN7 Antibody [NBP2-68921] - Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIN7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIN7A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for LIN7 Antibody

  • hLin-7
  • lin-7 homolog A (C. elegans)
  • LIN7
  • LIN-7A
  • MALS1
  • MALS-1MGC148143
  • Mammalian lin-seven protein 1
  • Tax interaction protein 33
  • TIP-33mammalian LIN-7 1
  • veli-1
  • VELI1protein lin-7 homolog A
  • vertebrate LIN7 homolog 1
  • Vertebrate lin-7 homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-53082
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02852
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-76922
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83716
Species: Hu
Applications: IHC, IHC-P
NBP1-87365
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-82856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
1849-NK
Species: Hu
NB100-1354
Species: Hu
Applications: Flow, PEP-ELISA, IF
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu
Applications: IHC, IHC-P
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-68921
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for LIN7 Antibody (NBP2-68921) (0)

There are no publications for LIN7 Antibody (NBP2-68921).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIN7 Antibody (NBP2-68921) (0)

There are no reviews for LIN7 Antibody (NBP2-68921). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LIN7 Antibody (NBP2-68921) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LIN7 Products

Bioinformatics Tool for LIN7 Antibody (NBP2-68921)

Discover related pathways, diseases and genes to LIN7 Antibody (NBP2-68921). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIN7 Antibody (NBP2-68921)

Discover more about diseases related to LIN7 Antibody (NBP2-68921).
 

Pathways for LIN7 Antibody (NBP2-68921)

View related products by pathway.

PTMs for LIN7 Antibody (NBP2-68921)

Learn more about PTMs related to LIN7 Antibody (NBP2-68921).

Blogs on LIN7

There are no specific blogs for LIN7, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIN7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIN7A
Novus 100% Guarantee