Recombinant Human LHX6 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human LHX6 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 274-363 of Human LHX6

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
LHX6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LHX6 GST (N-Term) Protein

  • LHX6.1LIM homeobox protein 6
  • LIM homeobox 6
  • LIM homeodomain protein 6.1
  • LIM/homeobox protein Lhx6
  • LIM/homeobox protein Lhx6.1
  • MGC119542
  • MGC119544
  • MGC119545

Background

LHX6 - LIM homeobox 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57782
Species: Hu
Applications: WB, ICC/IF
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5065
Species: Hu, Mu, Rt
Applications: WB, IHC
423-F8/CF
Species: Hu, Mu
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP1-02161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-89481
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-86114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-16178
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl

Publications for LHX6 Partial Recombinant Protein (H00026468-Q01) (0)

There are no publications for LHX6 Partial Recombinant Protein (H00026468-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHX6 Partial Recombinant Protein (H00026468-Q01) (0)

There are no reviews for LHX6 Partial Recombinant Protein (H00026468-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LHX6 Partial Recombinant Protein (H00026468-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional LHX6 Products

Array H00026468-Q01

Bioinformatics Tool for LHX6 Partial Recombinant Protein (H00026468-Q01)

Discover related pathways, diseases and genes to LHX6 Partial Recombinant Protein (H00026468-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHX6 Partial Recombinant Protein (H00026468-Q01)

Discover more about diseases related to LHX6 Partial Recombinant Protein (H00026468-Q01).
 

Pathways for LHX6 Partial Recombinant Protein (H00026468-Q01)

View related products by pathway.

PTMs for LHX6 Partial Recombinant Protein (H00026468-Q01)

Learn more about PTMs related to LHX6 Partial Recombinant Protein (H00026468-Q01).

Blogs on LHX6

There are no specific blogs for LHX6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LHX6 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LHX6