Recombinant Human LHX2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LHX2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 27760 of Human LHX2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
LHX2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LHX2 Protein

  • hLhx2
  • Homeobox protein LH-2
  • LH-2
  • LH2MGC138390
  • LIM homeobox 2
  • LIM homeobox protein 2
  • LIM HOX gene 2
  • LIM/homeobox protein Lhx2

Background

LHX2 - LIM homeobox 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005352-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
H00008985-B01P
Species: Hu
Applications: WB, ICC/IF
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-86114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56467
Species: Hu, Ca, Pm
Applications: WB
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
H00338917-T01
Species: Hu
NBP2-01926
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82478
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
AF2567
Species: Mu
Applications: WB, IHC
H00009355-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for LHX2 Partial Recombinant Protein (H00009355-Q01) (0)

There are no publications for LHX2 Partial Recombinant Protein (H00009355-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHX2 Partial Recombinant Protein (H00009355-Q01) (0)

There are no reviews for LHX2 Partial Recombinant Protein (H00009355-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LHX2 Partial Recombinant Protein (H00009355-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LHX2 Products

Bioinformatics Tool for LHX2 Partial Recombinant Protein (H00009355-Q01)

Discover related pathways, diseases and genes to LHX2 Partial Recombinant Protein (H00009355-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHX2 Partial Recombinant Protein (H00009355-Q01)

Discover more about diseases related to LHX2 Partial Recombinant Protein (H00009355-Q01).
 

Pathways for LHX2 Partial Recombinant Protein (H00009355-Q01)

View related products by pathway.

PTMs for LHX2 Partial Recombinant Protein (H00009355-Q01)

Learn more about PTMs related to LHX2 Partial Recombinant Protein (H00009355-Q01).

Blogs on LHX2

There are no specific blogs for LHX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LHX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LHX2