Recombinant Human LHFPL5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LHFPL5 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 219 of Human LHFPL5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWIGDSVNTPQAGYFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALGMFLIIGSIICFSLFFICNTATVYKICAWMQLAAATGLMIGCLVYPDGWDSSEVRRMCGEQTGKYTLGHCTIRWAFMLAILSIGDALILSFLAFVLGYRQDKLLPDDYKADGTEEV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
LHFPL5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LHFPL5 Protein

  • DFNB67
  • dJ510O8.8
  • LHFP-like protein 5
  • Lipoma HMGIC fusion partner-like 5 protein
  • lipoma HMGIC fusion partner-like 5
  • MGC33835
  • tetraspan membrane protein of hair cell stereocilia
  • Tmhs
  • TMHSdeafness, autosomal recessive 67

Background

This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in this gene result in deafness in humans, and a mutation in a similar gene in mice results in deafness and vestibular dysfunction with severe degeneration of the organ of Corti. It is proposed to function in hair bundle morphogenesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43728
Species: Hu
Applications: WB, ICC/IF
H00007348-M05
Species: Hu
Applications: WB, ELISA
NBP1-59438
Species: Hu
Applications: WB, ELISA, IHC
NBP1-86225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57678
Species: Hu
Applications: ICC/IF
NLS6871
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NB600-230
Species: Hu
Applications: WB
H00006732-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-55795
Species: Hu
Applications: ICC/IF
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00222662-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for LHFPL5 Recombinant Protein (H00222662-P01) (0)

There are no publications for LHFPL5 Recombinant Protein (H00222662-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHFPL5 Recombinant Protein (H00222662-P01) (0)

There are no reviews for LHFPL5 Recombinant Protein (H00222662-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LHFPL5 Recombinant Protein (H00222662-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LHFPL5 Products

Bioinformatics Tool for LHFPL5 Recombinant Protein (H00222662-P01)

Discover related pathways, diseases and genes to LHFPL5 Recombinant Protein (H00222662-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHFPL5 Recombinant Protein (H00222662-P01)

Discover more about diseases related to LHFPL5 Recombinant Protein (H00222662-P01).

Blogs on LHFPL5

There are no specific blogs for LHFPL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LHFPL5 Antibody
NBP2-30662

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LHFPL5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LHFPL5