Lgi4 Antibody

Images

 
Immunohistochemistry: Lgi4 Antibody [NBP2-30545] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lgi4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DTLTHVDLRGNPFQCDCRVLWLLQWMPTVNASVGTGACAGPASLSHMQLHHLDPKTFKCRAIELSWFQTVGESALSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LGI4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lgi4 Protein (NBP2-30545PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lgi4 Antibody

  • leucine-rich glioma-inactivated gene 4
  • Leucine-rich glioma-inactivated protein 4
  • leucine-rich repeat LGI family member 4
  • leucine-rich repeat LGI family, member 4
  • LGI1-like protein 3
  • LGIL3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77320
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
MAB49081
Species: Hu
Applications: WB, IP
NBP1-76383
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB7334
Species: Hu
Applications: WB, ICC
NBP2-49512
Species: Hu
Applications: IHC
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-34980
Species: Hu
NBP2-38245
Species: Hu
Applications: IHC, IHC-P
NBP2-13738
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-20149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01991
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-58876
Species: Hu
Applications: ICC/IF
MAB4974
Species: Hu
Applications: IHC
NBP2-04663
Species: Hu
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-85585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15667
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30545
Species: Hu
Applications: IHC, IHC-P

Publications for Lgi4 Antibody (NBP2-30545) (0)

There are no publications for Lgi4 Antibody (NBP2-30545).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lgi4 Antibody (NBP2-30545) (0)

There are no reviews for Lgi4 Antibody (NBP2-30545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lgi4 Antibody (NBP2-30545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lgi4 Products

Bioinformatics Tool for Lgi4 Antibody (NBP2-30545)

Discover related pathways, diseases and genes to Lgi4 Antibody (NBP2-30545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lgi4 Antibody (NBP2-30545)

Discover more about diseases related to Lgi4 Antibody (NBP2-30545).
 

Pathways for Lgi4 Antibody (NBP2-30545)

View related products by pathway.

PTMs for Lgi4 Antibody (NBP2-30545)

Learn more about PTMs related to Lgi4 Antibody (NBP2-30545).

Blogs on Lgi4

There are no specific blogs for Lgi4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lgi4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LGI4
Uniprot