LGI2 Antibody

Images

 
Western Blot: LGI2 Antibody [NBP1-83839] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: LGI2 Antibody [NBP1-83839] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Immunohistochemistry-Paraffin: LGI2 Antibody [NBP1-83839] - Staining of human parathyroid gland shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LGI2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DLTHLSLANNHIKALPRDVFSDLDSLIELDLRGNKFECDCKAKWLYLWLKMTNSTVSDVLCIGPPEYQEKKLNDVTSFDYECTTTDFVVHQTLPYQSVSVDTFNSKNDVYVAIAQPSMENCMVLEW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LGI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LGI2 Protein (NBP1-83839PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LGI2 Antibody

  • FLJ10675
  • glioma inactivated 2
  • KIAA1916MGC126810
  • leucine-rich repeat LGI family, member 2
  • LGI1-like protein 2
  • LGI2
  • LGIL2
  • MGC126808

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77320
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-76383
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-30423
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00064699-M01
Species: Hu
Applications: WB, ELISA
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82120
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56991
Species: Hu
Applications: WB
MAB4974
Species: Hu
Applications: IHC
NBP2-55659
Species: Hu
Applications: IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-80638
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS1729
Species: Hu, Eq
Applications: WB, IHC-P
NBP2-55995
Species: Hu
Applications: ICC/IF
NBP1-83839
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LGI2 Antibody (NBP1-83839) (0)

There are no publications for LGI2 Antibody (NBP1-83839).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LGI2 Antibody (NBP1-83839) (0)

There are no reviews for LGI2 Antibody (NBP1-83839). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LGI2 Antibody (NBP1-83839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LGI2 Products

Bioinformatics Tool for LGI2 Antibody (NBP1-83839)

Discover related pathways, diseases and genes to LGI2 Antibody (NBP1-83839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LGI2 Antibody (NBP1-83839)

Discover more about diseases related to LGI2 Antibody (NBP1-83839).
 

Pathways for LGI2 Antibody (NBP1-83839)

View related products by pathway.

PTMs for LGI2 Antibody (NBP1-83839)

Learn more about PTMs related to LGI2 Antibody (NBP1-83839).

Blogs on LGI2

There are no specific blogs for LGI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LGI2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LGI2
Entrez