Recombinant Human Lgi3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Lgi3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 449-548 of Human Lgi3

Source: Wheat Germ

Amino Acid Sequence: LRWEGTRFSEVQALPSRGSLALQPFLVGGRRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHIVVDLSA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
LGI3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Lgi3 Protein

  • Leucine-rich glioma-inactivated protein 3
  • leucine-rich repeat LGI family member 3
  • leucine-rich repeat LGI family, member 3
  • LGI1-like protein 4
  • LGI3
  • LGIL4

Background

LGI3 - leucine-rich repeat LGI family, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77320
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-30423
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB7334
Species: Hu
Applications: WB, ICC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB4974
Species: Hu
Applications: IHC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67246
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB49081
Species: Hu
Applications: WB, IP
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87498
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88227
Species: Hu
Applications: WB, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00203190-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Lgi3 Partial Recombinant Protein (H00203190-Q01) (0)

There are no publications for Lgi3 Partial Recombinant Protein (H00203190-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lgi3 Partial Recombinant Protein (H00203190-Q01) (0)

There are no reviews for Lgi3 Partial Recombinant Protein (H00203190-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lgi3 Partial Recombinant Protein (H00203190-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lgi3 Products

Bioinformatics Tool for Lgi3 Partial Recombinant Protein (H00203190-Q01)

Discover related pathways, diseases and genes to Lgi3 Partial Recombinant Protein (H00203190-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lgi3 Partial Recombinant Protein (H00203190-Q01)

Discover more about diseases related to Lgi3 Partial Recombinant Protein (H00203190-Q01).
 

Pathways for Lgi3 Partial Recombinant Protein (H00203190-Q01)

View related products by pathway.

PTMs for Lgi3 Partial Recombinant Protein (H00203190-Q01)

Learn more about PTMs related to Lgi3 Partial Recombinant Protein (H00203190-Q01).

Blogs on Lgi3

There are no specific blogs for Lgi3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Lgi3 Blocking Peptide
NBP1-76383PEP
GFAP Antibody
NB300-141
Lgi3 Antibody
NBP1-76383

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Lgi3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LGI3
Entrez