Recombinant Human Lgi3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Lgi3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 449 - 548 of Human LGI3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LRWEGTRFSEVQALPSRGSLALQPFLVGGRRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHIVVDLSA

Protein/Peptide Type
Partial Recombinant Protein
Gene
LGI3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Lgi3 Protein

  • Leucine-rich glioma-inactivated protein 3
  • leucine-rich repeat LGI family member 3
  • leucine-rich repeat LGI family, member 3
  • LGI1-like protein 4
  • LGI3
  • LGIL4

Background

LGI3 - leucine-rich repeat LGI family, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77320
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-30423
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB7334
Species: Hu
Applications: WB, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB4974
Species: Hu
Applications: IHC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55995
Species: Hu
Applications: ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB49081
Species: Hu
Applications: WB, IP
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-79022
Species: Hu, Mu
Applications: WB, IP
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1747
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for Lgi3 Partial Recombinant Protein (H00203190-Q01) (0)

There are no publications for Lgi3 Partial Recombinant Protein (H00203190-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lgi3 Partial Recombinant Protein (H00203190-Q01) (0)

There are no reviews for Lgi3 Partial Recombinant Protein (H00203190-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lgi3 Partial Recombinant Protein (H00203190-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lgi3 Products

Bioinformatics Tool for Lgi3 Partial Recombinant Protein (H00203190-Q01)

Discover related pathways, diseases and genes to Lgi3 Partial Recombinant Protein (H00203190-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lgi3 Partial Recombinant Protein (H00203190-Q01)

Discover more about diseases related to Lgi3 Partial Recombinant Protein (H00203190-Q01).
 

Pathways for Lgi3 Partial Recombinant Protein (H00203190-Q01)

View related products by pathway.

PTMs for Lgi3 Partial Recombinant Protein (H00203190-Q01)

Learn more about PTMs related to Lgi3 Partial Recombinant Protein (H00203190-Q01).

Blogs on Lgi3

There are no specific blogs for Lgi3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Lgi3 Blocking Peptide
NBP1-76383PEP
GFAP Antibody
NB300-141
Lgi3 Antibody
NBP1-76383

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Lgi3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LGI3
Entrez