Leupaxin Antibody - Azide and BSA Free Summary
| Immunogen |
LPXN (NP_004802.1, 1 a.a. - 386 a.a.) full-length human protein. MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL |
| Specificity |
LPXN - leupaxin, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
LPXN |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Leupaxin Antibody - Azide and BSA Free
Background
The product encoded by this gene is preferentially expressed in hematopoietic cells and is most homologous to the focal adhesion protein, paxillin. It may function in cell type-specific signaling by associating with PYK2, a member of focal adhesion kinase family. As a substrate for a tyrosine kinase in lymphoid cells, this protein may also function in, and be regulated by tyrosine kinase activity. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Ch, Hu, Mu, Pm, Rb, Rt, RM, Xp, Ze
Applications: ICC/IF, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: IHC, WB
Species: Am, Bv, Ca, Ch, Hu, Mu, Rt, Tr
Applications: ICC/IF, IHC, IHC-Fr, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Publications for Leupaxin Antibody (H00009404-B01P) (0)
There are no publications for Leupaxin Antibody (H00009404-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Leupaxin Antibody (H00009404-B01P) (0)
There are no reviews for Leupaxin Antibody (H00009404-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Leupaxin Antibody (H00009404-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Leupaxin Products
Research Areas for Leupaxin Antibody (H00009404-B01P)
Find related products by research area.
|
Blogs on Leupaxin