Leupaxin Antibody - Azide and BSA Free

Western Blot: Leupaxin Antibody [H00009404-B01P] - Analysis of LPXN expression in transfected 293T cell line by LPXN polyclonal antibody. Lane 1: LPXN transfected lysate(42.46 KDa). Lane 2: Non-transfected lysate.

Western Blot: Leupaxin Antibody [H00009404-B01P] - analysis of LPXN expression in transfected 293T cell line by LPXN MaxPab polyclonal antibody. Lane 1: LPXN transfected lysate (42.46 KDa). Lane 2: Non-transfected lysate.

Western Blot: Leupaxin Antibody [H00009404-B01P] - LPXN MaxPab polyclonal antibody. Western Blot analysis of LPXN expression in human spleen.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Leupaxin Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Leupaxin Antibody - Azide and BSA Free (H00009404-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LPXN (NP_004802.1, 1 a.a. - 386 a.a.) full-length human protein. MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL
• Specificity: LPXN - leupaxin,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: LPXN
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Leupaxin Antibody - Azide and BSA Free

• LDLP
• LDPL
• leupaxin

Background

The product encoded by this gene is preferentially expressed in hematopoietic cells and is most homologous to the focal adhesion protein, paxillin. It may function in cell type-specific signaling by associating with PYK2, a member of focal adhesion kinase family. As a substrate for a tyrosine kinase in lymphoid cells, this protein may also function in, and be regulated by tyrosine kinase activity. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LPXN
• Entrez:
  • 9404(Human)
• Uniprot:
  • NP_004802.1(Human)