![Immunohistochemistry-Paraffin: LEPROTL1 Antibody [NBP2-14626] - Staining of human colon shows strong cytoplasmic positivity in endothelial cells.](http://images.novusbio.com/fullsize/LEPROTL1-Antibody-Immunohistochemistry-Paraffin-NBP2-14626-img0002.jpg "Immunohistochemistry-Paraffin: LEPROTL1 Antibody [NBP2-14626] - Staining of human colon shows strong cytoplasmic positivity in endothelial cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: GRLPFFSKMGTAESEGRETLTQQLPLPAAAMRRLLPASRVSTQPVLRLADSAESLLGRPALWALGFLLCPPSQAQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LEPROTL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/16321.jpg)
![Knockout Validated STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Knockout_Validated_21968.jpg)
![Immunocytochemistry STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Immunocytochemistry__Immunofluorescence_17603.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LEPROTL1 |
![Immunohistochemistry Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images2/Leptin_R_AF497_Immunohistochemistry_6850.jpg)
![Western Blot Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images/af497_mouse-leptin-r-affinity-purified-polyclonal-ab-41202410481130.jpg)
![Immunohistochemistry Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af497_mouse-leptin-r-affinity-purified-polyclonal-ab-immunohistochemistry-251120248493..jpg)
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Western Blot STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Western_Blot_5176.jpg)
![Simple Western STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16339.jpg)
![Chromatin Immunoprecipitation (ChIP) STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Chromatin_Immunoprecipitation_11246.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")