LEPROTL1 Antibody

Images

 
Immunohistochemistry-Paraffin: LEPROTL1 Antibody [NBP2-14626] - Staining of human colon shows strong cytoplasmic positivity in endothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LEPROTL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GRLPFFSKMGTAESEGRETLTQQLPLPAAAMRRLLPASRVSTQPVLRLAD SAESLLGRPALWALGFLLCPPSQAQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LEPROTL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LEPROTL1 Protein (NBP2-14626PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LEPROTL1 Antibody

  • HSPC112
  • LEPROTL1 leptin receptor overlapping transcript-like 1
  • my047
  • Vps55

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF497
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
AF1049
Species: Hu
Applications: IHC, WB
NBP2-57596
Species: Hu
Applications: ICC/IF
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
DLP00
Species: Hu
Applications: ELISA
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
AF4979
Species: Hu
Applications: WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
AF1360
Species: Mu
Applications: IHC, WB

Publications for LEPROTL1 Antibody (NBP2-14626) (0)

There are no publications for LEPROTL1 Antibody (NBP2-14626).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LEPROTL1 Antibody (NBP2-14626) (0)

There are no reviews for LEPROTL1 Antibody (NBP2-14626). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LEPROTL1 Antibody (NBP2-14626) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LEPROTL1 Products

Bioinformatics Tool for LEPROTL1 Antibody (NBP2-14626)

Discover related pathways, diseases and genes to LEPROTL1 Antibody (NBP2-14626). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LEPROTL1 Antibody (NBP2-14626)

Discover more about diseases related to LEPROTL1 Antibody (NBP2-14626).
 

Pathways for LEPROTL1 Antibody (NBP2-14626)

View related products by pathway.

PTMs for LEPROTL1 Antibody (NBP2-14626)

Learn more about PTMs related to LEPROTL1 Antibody (NBP2-14626).

Blogs on LEPROTL1

There are no specific blogs for LEPROTL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LEPROTL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LEPROTL1