Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen

Images

 
There are currently no images for Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LGMN.

Source: E. coli

Amino Acid Sequence: QGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LGMN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87793.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen

  • AEP
  • Asparaginyl Endopeptidase
  • cysteine protease 1
  • Legumain
  • LGMN
  • LGMN1
  • Protease, cysteine 1
  • protease, cysteine, 1 (legumain)
  • PRSC1EC 3.4.22.34

Background

Legumain encodes a cysteine protease that has a strict specificity for hydrolysis of asparaginyl bonds. This enzyme may be involved in the processing of bacterial peptides and endogenous proteins for MHC class II presentation in the lysosomal/endosomal systems. Enzyme activation is triggered by acidic pH and appears to be autocatalytic. Protein expression occurs after monocytes differentiate into dendritic cells. A fully mature, active enzyme is produced following lipopolysaccharide expression in mature dendritic cells. Overexpression of this gene may be associated with the majority of solid tumor types. This gene has a pseudogene on chromosome 13. Several alternatively spliced transcript variants have been described, but the biological validity of only two has been determined. These two variants encode the same isoform. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF965
Species: Mu
Applications: IHC, Neut, WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-62583
Species: Hu
Applications: WB
AF1286
Species: Hu
Applications: IHC, IP, Simple Western, WB
NBP1-84957
Species: Hu
Applications: IHC, IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF2340
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
AF3749
Species: Hu
Applications: IHC, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87793PEP
Species: Hu
Applications: AC

Publications for Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP) (0)

There are no publications for Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP) (0)

There are no reviews for Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Legumain/Asparaginyl Endopeptidase Products

Bioinformatics Tool for Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP)

Discover related pathways, diseases and genes to Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP)

Discover more about diseases related to Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP).
 

Pathways for Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP)

View related products by pathway.

Research Areas for Legumain/Asparaginyl Endopeptidase Protein (NBP1-87793PEP)

Find related products by research area.

Blogs on Legumain/Asparaginyl Endopeptidase

There are no specific blogs for Legumain/Asparaginyl Endopeptidase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Legumain/Asparaginyl Endopeptidase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LGMN