Lebercilin Antibody - BSA Free

Staining of human cell line Rh30 shows localization to centriolar satellites.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Lebercilin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Lebercilin Antibody - BSA Free (NBP3-24952) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Lebercilin using the following amino acid sequence: HQAPRKPSPKGLPNRKGVRVGFRSQSLNREPLRKDTDLVTKRILSARLLKINELQNEVSELQVKLAELLKENKSLKRLQYRQEKALNKFEDAENEISQL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LCA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lebercilin Antibody - BSA Free

• C6orf152Leber congenital amaurosis 5 protein
• chromosome 6 open reading frame 152
• Leber congenital amaurosis 5
• Lebercilin

Background

The LCA5 gene encodes a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this genecause Leber congenital amaurosis type V. Alternatively spliced transcript variants are described. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LCA5