SPATA7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SPATA7 Antibody [NBP1-83195] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: SPATA7 Antibody [NBP1-83195] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous tubules

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPATA7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPATA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPATA7 Protein (NBP1-83195PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPATA7 Antibody

  • HSD-3.1
  • HSD3DKFZp686D07199
  • LCA3
  • Leber congenital amaurosis 3
  • MGC102934
  • spermatogenesis associated 7
  • spermatogenesis-associated protein 7
  • Spermatogenesis-associated protein HSD3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56113
Species: Hu
Applications: IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-86759
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-46510
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01327
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13249
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00145226-D01P
Species: Hu
Applications: WB, ELISA
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-31401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8630
Species: Hu
Applications: WB, IHC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7450
Species: Hu
Applications: IHC

Publications for SPATA7 Antibody (NBP1-83195) (0)

There are no publications for SPATA7 Antibody (NBP1-83195).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA7 Antibody (NBP1-83195) (0)

There are no reviews for SPATA7 Antibody (NBP1-83195). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPATA7 Antibody (NBP1-83195) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPATA7 Products

Bioinformatics Tool for SPATA7 Antibody (NBP1-83195)

Discover related pathways, diseases and genes to SPATA7 Antibody (NBP1-83195). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA7 Antibody (NBP1-83195)

Discover more about diseases related to SPATA7 Antibody (NBP1-83195).
 

Pathways for SPATA7 Antibody (NBP1-83195)

View related products by pathway.

PTMs for SPATA7 Antibody (NBP1-83195)

Learn more about PTMs related to SPATA7 Antibody (NBP1-83195).

Blogs on SPATA7

There are no specific blogs for SPATA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA7