Lebercilin Antibody

Western Blot: Lebercilin Antibody [NBP1-55416] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Lebercilin Antibody Summary

• Immunogen: Synthetic peptides corresponding to Lebercilin. The peptide sequence was selected from the N terminal of Lebercilin. Peptide sequence FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LCA5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against Lebercilin and was validated on Western blot.
• Theoretical MW: 80 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Lebercilin Antibody

• C6orf152Leber congenital amaurosis 5 protein
• chromosome 6 open reading frame 152
• Leber congenital amaurosis 5
• Lebercilin

Background

The LCA5 gene encodes a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this genecause Leber congenital amaurosis type V. Alternatively spliced transcript variants are described. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Lebercilin Antibody (NBP1-55416)(1)

Publication using NBP1-55416

• Schleich S, Acevedo J. M, et al. Identification of transcripts with short stuORFs as targets for DENR MCTS1-dependent translation in human cells. Sci Rep 2017-06-16 [PMID: 28623304] (WB, Human)

Bioinformatics

• Gene Symbol: LCA5
• Uniprot:
  • Q86VQ0(Human)