LAX1 Antibody

Images

 
Western Blot: LAX1 Antibody [NBP1-83662] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: LAX1 Antibody [NBP1-83662] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: LAX1 Antibody [NBP1-83662] - Staining of human tonsil shows cytoplasmic positivity in lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LAX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQERQLWVAFQCCRDYENVPAADPSGSQQQAEKDVPSSNIGHVEDKTDDPGTHVQCVKRTFLASGDYADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LAX1 Protein (NBP1-83662PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAX1 Antibody

  • LAT-like membrane associated protein
  • LAX1
  • LAXFLJ20340
  • Linker for activation of X cells
  • lymphocyte transmembrane adapter 1
  • lymphocyte transmembrane adaptor 1
  • Membrane-associated adapter protein LAX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
H00084941-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB38461
Species: Hu
Applications: WB, IHC
AF6278
Species: Hu, Mu
Applications: WB
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
MAB342
Species: Hu
Applications: WB, AgAct
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22212
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
H00009139-M15
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for LAX1 Antibody (NBP1-83662) (0)

There are no publications for LAX1 Antibody (NBP1-83662).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAX1 Antibody (NBP1-83662) (0)

There are no reviews for LAX1 Antibody (NBP1-83662). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LAX1 Antibody (NBP1-83662) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LAX1 Products

Bioinformatics Tool for LAX1 Antibody (NBP1-83662)

Discover related pathways, diseases and genes to LAX1 Antibody (NBP1-83662). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAX1 Antibody (NBP1-83662)

Discover more about diseases related to LAX1 Antibody (NBP1-83662).
 

Pathways for LAX1 Antibody (NBP1-83662)

View related products by pathway.

PTMs for LAX1 Antibody (NBP1-83662)

Learn more about PTMs related to LAX1 Antibody (NBP1-83662).
 

Research Areas for LAX1 Antibody (NBP1-83662)

Find related products by research area.

Blogs on LAX1

There are no specific blogs for LAX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAX1
Entrez