LAX1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LAX1 Antibody [NBP1-83662] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.

Staining of human kidney shows no positivity as expected.

Staining of human liver shows no positivity as expected.

Analysis in human tonsil and skeletal muscle tissues using NBP1-83662 antibody. Corresponding LAX1 RNA-seq data are presented for the same tissues.

Staining of human skeletal muscle shows no positivity as expected.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Staining of human tonsil shows strong cytoplasmic positivity in a subset of non-germinal center cells).

Staining of human kidney, liver, skeletal muscle and tonsil using Anti-LAX1 antibody NBP1-83662 (A) shows similar protein distribution across tissues to independent antibody NBP1-83661 (B).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LAX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LAX1 Antibody - BSA Free (NBP1-83662) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQERQLWVAFQCCRDYENVPAADPSGSQQQAEKDVPSSNIGHVEDKTDDPGTHVQCVKRTFLASGDYADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LAX1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LAX1 Protein (NBP1-83662PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LAX1 Antibody - BSA Free

• LAT-like membrane associated protein
• LAX1
• LAXFLJ20340
• Linker for activation of X cells
• lymphocyte transmembrane adapter 1
• lymphocyte transmembrane adaptor 1
• Membrane-associated adapter protein LAX

Background

Negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LAX1