Latrophilin 3/LPHN3 Antibody

Images

 
Immunohistochemistry-Paraffin: Latrophilin 3/LPHN3 Antibody [NBP1-82962] - Staining of human stomach shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Latrophilin 3/LPHN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LCLAPDGIWDPQGPDLSNCSSPWVNHITQKLKSGETAANIARELAEQTRNHLNAGDITYSVRAMDQLVGLLDVQLRNLTPGGKDSAARSLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPHN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin: HIER pH 6 retrieval is recommended.
Control Peptide
Latrophilin 3/LPHN3 Protein (NBP1-82962PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Latrophilin 3/LPHN3 Antibody

  • CIRL3
  • Latrophilin 3
  • latrophilin homolog 3 (cow)
  • LEC3
  • Lectomedin-3
  • LPHN3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58704
Species: Hu
Applications: WB, ICC/IF
NBP1-85609
Species: Hu
Applications: IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00001815-R02
Species: Hu
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NLS418
Species: Hu
Applications: IHC-P
NBP1-81621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3446
Species: Hu
Applications: WB
NBP1-86515
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22444
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IF
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC

Publications for Latrophilin 3/LPHN3 Antibody (NBP1-82962) (0)

There are no publications for Latrophilin 3/LPHN3 Antibody (NBP1-82962).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Latrophilin 3/LPHN3 Antibody (NBP1-82962) (0)

There are no reviews for Latrophilin 3/LPHN3 Antibody (NBP1-82962). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Latrophilin 3/LPHN3 Antibody (NBP1-82962) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Latrophilin 3/LPHN3 Products

Bioinformatics Tool for Latrophilin 3/LPHN3 Antibody (NBP1-82962)

Discover related pathways, diseases and genes to Latrophilin 3/LPHN3 Antibody (NBP1-82962). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Latrophilin 3/LPHN3 Antibody (NBP1-82962)

Discover more about diseases related to Latrophilin 3/LPHN3 Antibody (NBP1-82962).
 

Pathways for Latrophilin 3/LPHN3 Antibody (NBP1-82962)

View related products by pathway.

PTMs for Latrophilin 3/LPHN3 Antibody (NBP1-82962)

Learn more about PTMs related to Latrophilin 3/LPHN3 Antibody (NBP1-82962).
 

Research Areas for Latrophilin 3/LPHN3 Antibody (NBP1-82962)

Find related products by research area.

Blogs on Latrophilin 3/LPHN3

There are no specific blogs for Latrophilin 3/LPHN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Latrophilin 3/LPHN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LPHN3
Entrez
Uniprot