Latent TGF-beta bp1 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1290-1540 of human Latent TGF-beta bp1 (NP_996826.2). CELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGFCLNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LTBP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:200-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Latent TGF-beta bp1 Antibody - Azide and BSA Free
Background
LTBP1, also known as latent-transforming growth factor beta-binding protein 1, consists of five isoforms of sizes 186.8 kDa, 152.9 kDa, 147.2 kDa, 186.9 kDa, and 153 kDa and is involved in directing and regulating the activity of TGFB1. Current research is being conducted on diseases and disorders such as cataracts, fibrosis, geleophysic dysplasia, macular degeneration, aortic aneurysm, malignant glioma, hepatitis, vaginitis, scleroderma, and nephropathy. The protein is involved in extracellular matrix organization, mitochondrial apoptosis, TGF-beta signaling, and GSK3 signaling pathways, where it interacts with FN1, FBN2, TGFB1, ITGB5, and ATN1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Latent TGF-beta bp1 Antibody (NBP3-03429) (0)
There are no publications for Latent TGF-beta bp1 Antibody (NBP3-03429).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Latent TGF-beta bp1 Antibody (NBP3-03429) (0)
There are no reviews for Latent TGF-beta bp1 Antibody (NBP3-03429).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Latent TGF-beta bp1 Antibody (NBP3-03429) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Latent TGF-beta bp1 Products
Research Areas for Latent TGF-beta bp1 Antibody (NBP3-03429)
Find related products by research area.
|
Blogs on Latent TGF-beta bp1