LAT Recombinant Protein Antigen

Images

 
There are currently no images for LAT Protein (NBP1-81324PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

LAT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAT.

Source: E. coli

Amino Acid Sequence: HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LAT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81324.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LAT Recombinant Protein Antigen

  • 36 kDa phospho-tyrosine adapter protein
  • LAT
  • LAT1,36 kDa phospho-tyrosine adaptor protein
  • linker for activation of T cells
  • linker for activation of T-cells family member 1
  • p36-38
  • pp36

Background

LAT (linker for activation of T-cells) is involved in the T-cell antigen receptor (TCR) signal transduction pathway, and may play an important role downstream in activating protein tyrosine kinases (1). LAT is phosphorylated by ZAP-70/Syk protein tyrosine kinases leading to recruitment of multiple signaling molecules (2). It has been found that Tyr191 and Tyr171 are required for T-cell activation and Tyr132 is required for the activation of PLCgamma1 and Ras signaling pathways, respectively. Tyr226 and Tyr191 are required for Vav binding, whereas Tyr171 and Tyr132 are necessary for association and activation of phosphoinositide 3-kinase activity and PLCgamma1 (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87000
Species: Hu
Applications: IHC,  IHC-P, WB
AF4066
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
MAB7474
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-47989
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-80662
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P
202-IL
Species: Hu
Applications: BA
MAB7500
Species: Hu
Applications: ICC, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
MAB37861
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
7268-CT
Species: Hu
Applications: BA

Publications for LAT Protein (NBP1-81324PEP) (0)

There are no publications for LAT Protein (NBP1-81324PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAT Protein (NBP1-81324PEP) (0)

There are no reviews for LAT Protein (NBP1-81324PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LAT Protein (NBP1-81324PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LAT Products

Research Areas for LAT Protein (NBP1-81324PEP)

Find related products by research area.

Blogs on LAT.

Cluster of Differentiation 3 (CD3) (OKT3 clone) as a Marker of Immune Response Efficiency
Our immune system is a powerful defense mechanism against infection, however different variables can cause our immune response to work for or against us.  CD3 (cluster of differentiation 3) is one component of our immune signal response that is co...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LAT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LAT