LARP7 Antibody


Western Blot: LARP7 Antibody [NBP1-85083] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-312
Immunohistochemistry-Paraffin: LARP7 Antibody [NBP1-85083] - Staining of human epididymis shows nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

LARP7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DSGVPQNTGMKNEKTANREECRTQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTLAAISEVLYVDLLEGDTECHA
Specificity of human LARP7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
LARP7 Protein (NBP1-85083PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LARP7 Antibody

  • DKFZp564K112
  • HDCMA18P
  • La ribonucleoprotein domain family member 7
  • La ribonucleoprotein domain family, member 7
  • la-related protein 7
  • PIP7SMGC104360
  • P-TEFb-interaction protein for 7SK stability


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LARP7 Antibody (NBP1-85083) (0)

There are no publications for LARP7 Antibody (NBP1-85083).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LARP7 Antibody (NBP1-85083) (0)

There are no reviews for LARP7 Antibody (NBP1-85083). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LARP7 Antibody (NBP1-85083) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LARP7 Products

Bioinformatics Tool for LARP7 Antibody (NBP1-85083)

Discover related pathways, diseases and genes to LARP7 Antibody (NBP1-85083). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LARP7 Antibody (NBP1-85083)

Discover more about diseases related to LARP7 Antibody (NBP1-85083).

Pathways for LARP7 Antibody (NBP1-85083)

View related products by pathway.

PTMs for LARP7 Antibody (NBP1-85083)

Learn more about PTMs related to LARP7 Antibody (NBP1-85083).

Blogs on LARP7

There are no specific blogs for LARP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LARP7 Antibody and receive a gift card or discount.


Gene Symbol LARP7