LARP1 Antibody [Janelia Fluor® 549]

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Janelia Fluor 549

LARP1 Antibody [Janelia Fluor® 549] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 106-205 of human LARP1 (Q6PKG0).
  
  Sequence:
  AGAAGAGRRDFVEAPPPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LARP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

Alternate Names for LARP1 Antibody [Janelia Fluor® 549]

• KIAA0731LARPMGC19556
• La ribonucleoprotein domain family member 1
• La ribonucleoprotein domain family, member 1
• la-related protein 1

Background

LARP1 (la-related protein 1) is part of a family of proteins that bears a La motif. The La motif was first identified in the La protein which was isolated as an autoreactive antigen in patients afflicted with systemic lupus erythematosus. Like the La protein, LARP proteins appear to be RNA-binding proteins, and are proposed to play a role in translation elongation and termination. Alternative names for LARP1 include la ribonucleoprotein domain family member 1, LARP, and KIAA0731.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LARP1