VPS13D Antibody

Images

 
Immunohistochemistry-Paraffin: VPS13D Antibody [NBP2-14742] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: VPS13D Antibody [NBP2-14742] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non germinal center cells.
Immunohistochemistry-Paraffin: VPS13D Antibody [NBP2-14742] - Staining of human skin shows strong cytoplasmic positivity in mast cell.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS13D Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS13D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VPS13D Protein (NBP2-14742PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS13D Antibody

  • VPS13D vacuolar protein sorting 13 homolog D (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85641
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-55104
Species: Hu
Applications: ICC/IF, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
MAB6890
Species: Hu, Mu
Applications: ICC, WB
NBP1-19128
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-2383
Species: Hu
Applications: ICC/IF, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-32252
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88937
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
MAB864
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB4458
Species: Hu
Applications: IHC, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-46316
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-76798
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
NBP2-14742
Species: Hu, Mu, Rt
Applications: IHC

Publications for VPS13D Antibody (NBP2-14742) (0)

There are no publications for VPS13D Antibody (NBP2-14742).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS13D Antibody (NBP2-14742) (0)

There are no reviews for VPS13D Antibody (NBP2-14742). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VPS13D Antibody (NBP2-14742) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS13D Products

Diseases for VPS13D Antibody (NBP2-14742)

Discover more about diseases related to VPS13D Antibody (NBP2-14742).
 

Pathways for VPS13D Antibody (NBP2-14742)

View related products by pathway.

PTMs for VPS13D Antibody (NBP2-14742)

Learn more about PTMs related to VPS13D Antibody (NBP2-14742).

Blogs on VPS13D

There are no specific blogs for VPS13D, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS13D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS13D