LAPTM5 Antibody - Azide and BSA Free

Western Blot: LAPTM5 Antibody [NBP2-94465] - Analysis of extracts of Rat thymus, using LAPTM5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.

Western Blot: LAPTM5 Antibody [NBP2-94465] - Analysis of extracts of various cell lines, using LAPTM5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LAPTM5 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit LAPTM5 Antibody - Azide and BSA Free (NBP2-94465) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 153-262 of human LAPTM5 (NP_006753.1). SSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LAPTM5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for LAPTM5 Antibody - Azide and BSA Free

• CD40-ligand-activated specific transcripts
• CLAST6
• FLJ61683
• FLJ97251
• human retinoic acid-inducible E3 protein
• KIAA0085
• lysosomal associated multispanning membrane protein 5
• lysosomal multispanning membrane protein 5
• lysosomal protein transmembrane 5
• Lysosomal-associated multitransmembrane protein 5
• lysosomal-associated transmembrane protein 5
• MGC125860
• MGC125861
• Retinoic acid-inducible E3 protein

Background

The LAPTM5 gene encodes a transmembrane receptor that is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LAPTM5