LAP1B Antibody - BSA Free

Western Blot: LAP1B Antibody [NBP3-10080] - Western blot analysis of LAP1B in Human OVCAR-3 Whole Cell lysates. Antibody dilution at 1ug/ml

Product Discontinued

LAP1B Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LAP1B (NP_001254507.1). Peptide sequence TLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOR1AIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LAP1B Antibody - BSA Free

• DKFZp586G011
• FLJ13142
• lamina associated polypeptide 1B
• lamina-associated polypeptide 1B
• LAP1B
• MGC3413
• torsin A interacting protein 1
• torsin-1A-interacting protein 1

Background

Lamina-associated polypeptide 1B (LAPB1) binds to A- and B-type lamins. It is a single-pass membrane protein that localizes to the inner membrane of the nucleus and may play a role in membrane attachment and the assembly of the nuclear lamina. LAPB1 is also called torsin-1A-interacting protein 1 (TOR1AIP1) due to its association with torsin, an ATPase of the AAA- (adenosine triphosphatases associated with diverse cellular activities) family of proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOR1AIP1