Laminin beta 3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Laminin beta 3 Antibody [NBP1-89956] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Analysis in human cell lines A-431 and MCF-7 using Anti-LAMB3 antibody. Corresponding LAMB3 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Laminin beta 3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LAMB3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in (PMID: 23159910).
• Control Peptide:

  Laminin beta 3 Protein (NBP1-89956PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23159910).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Laminin beta 3 Antibody - BSA Free

• BM600-125kDa
• Epiligrin subunit bata
• FLJ99565
• Kalinin B1 chain
• Kalinin subunit beta
• kalinin-140kDa
• LAM5
• Laminin 5
• Laminin B1k chain
• laminin S B3 chain
• laminin subunit beta-3
• laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD))
• laminin, beta 3
• Laminin-5 subunit beta
• LAMNB1
• Nicein subunit beta
• nicein-125kDa

Background

The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Laminin beta 3 Antibody (NBP1-89956)(2)

Publications using NBP1-89956

• YAMAMOTO N, KINOSHITA T, NOHATA N et al. Tumor suppressive microRNA-218 inhibits cancer cell migration and invasion by targeting focal adhesion pathways in cervical squamous cell carcinoma. Int J Oncol 2013-05-01 [PMID: 23483249]
• Kinoshita T, Hanazawa T, Nohata N et al. Tumor suppressive microRNA-218 inhibits cancer cell migration and invasion through targeting laminin-332 in head and neck squamous cell carcinoma. Oncotarget 2012-11-01 [PMID: 23159910] (WB, Human)

Bioinformatics

• Gene Symbol: LAMB3