Laminin beta 3 Antibody

Images

 
Immunohistochemistry: Laminin beta 3 Antibody [NBP1-89956] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Laminin beta 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Laminin beta 3 Protein (NBP1-89956PEP)
Publications
Read Publications using
NBP1-89956 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23159910).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Laminin beta 3 Antibody

  • BM600-125kDa
  • Epiligrin subunit bata
  • FLJ99565
  • Kalinin B1 chain
  • Kalinin subunit beta
  • kalinin-140kDa
  • LAM5
  • Laminin 5
  • Laminin B1k chain
  • laminin S B3 chain
  • laminin subunit beta-3
  • laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD))
  • laminin, beta 3
  • Laminin-5 subunit beta
  • LAMNB1
  • Nicein subunit beta
  • nicein-125kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
MAB2144
Species: Hu
Applications: WB, IHC, IP, AdBlk, ICC
NBP2-42392
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91800
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2728
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30604
Species: Hu
Applications: IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
24420002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-86061
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-90312
Species: Hu
Applications: IHC, IHC-P

Publications for Laminin beta 3 Antibody (NBP1-89956)(2)

Reviews for Laminin beta 3 Antibody (NBP1-89956) (0)

There are no reviews for Laminin beta 3 Antibody (NBP1-89956). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Laminin beta 3 Antibody (NBP1-89956) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Laminin beta 3 Products

Bioinformatics Tool for Laminin beta 3 Antibody (NBP1-89956)

Discover related pathways, diseases and genes to Laminin beta 3 Antibody (NBP1-89956). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin beta 3 Antibody (NBP1-89956)

Discover more about diseases related to Laminin beta 3 Antibody (NBP1-89956).
 

Pathways for Laminin beta 3 Antibody (NBP1-89956)

View related products by pathway.

PTMs for Laminin beta 3 Antibody (NBP1-89956)

Learn more about PTMs related to Laminin beta 3 Antibody (NBP1-89956).

Blogs on Laminin beta 3

There are no specific blogs for Laminin beta 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin beta 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMB3