Recombinant Human Laminin alpha 2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Laminin alpha 2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 3013 - 3122 of Human LAMA2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN

Protein/Peptide Type
Partial Recombinant Protein
Gene
LAMA2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Laminin alpha 2 Protein

  • Laminin M chain
  • laminin subunit alpha-2
  • laminin, alpha 2
  • Laminin-12 subunit alpha
  • Laminin-2 subunit alpha
  • LAMMLaminin-4 subunit alpha
  • Merosin heavy chain

Background

LAMA2 - laminin, alpha 2 (merosin, congenital muscular dystrophy)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-33383
Species: Hu
Applications: WB, ICC/IF
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-144
Species: Hu, Mu, Rt, In, Rb, Sh
Applications: WB, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55584
Species: Hu
Applications: ICC/IF
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-42392
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-94712
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003908-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01) (0)

There are no publications for Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01) (0)

There are no reviews for Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Laminin alpha 2 Products

Bioinformatics Tool for Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01)

Discover related pathways, diseases and genes to Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01)

Discover more about diseases related to Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01).
 

Pathways for Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01)

View related products by pathway.

PTMs for Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01)

Learn more about PTMs related to Laminin alpha 2 Partial Recombinant Protein (H00003908-Q01).

Blogs on Laminin alpha 2

There are no specific blogs for Laminin alpha 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Laminin alpha 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMA2