Home » Laminin alpha 2 » Laminin alpha 2 Antibodies » Laminin alpha 2 Antibody (2D4) [Biotin]

Laminin alpha 2 Antibody (2D4) [Biotin]

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related Laminin alpha 2 Primary Antibodies

Order Details


    • Catalog Number
      H00003908-M01B
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Laminin alpha 2 Antibody (2D4) [Biotin] Summary

Immunogen
LAMA2 (NP_000417, 3013 a.a. ~ 3122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
Localization
Extracellular
Specificity
LAMA2 - laminin, alpha 2 (merosin, congenital muscular dystrophy)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LAMA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS (pH 7.4)
Preservative
0.05% Sodium Azide
Purity
IgG purified

Alternate Names for Laminin alpha 2 Antibody (2D4) [Biotin]

  • LAMA2
  • Laminin alpha 2
  • Laminin M chain
  • laminin subunit alpha-2
  • laminin, alpha 2
  • Laminin-12 subunit alpha
  • Laminin-2 subunit alpha
  • LAMM
  • LAMMLaminin-4 subunit alpha
  • Merosin heavy chain
  • Merosin

Background

Laminin, an extracellular protein, is a major component of the basement membrane. It is thought to mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. It is composed of three subunits, alpha, beta, and gamma, which are bound to each other by disulfide bonds into a cross-shaped molecule. This gene encodes the alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Mutations in this gene have been identified as the cause of congenital merosin-deficient muscular dystrophy. Two transcript variants encoding different proteins have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining in human skeletal muscle and tonsil tissues. Corresponding DMD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
FKTN Antibody
NBP1-33383
Western Blot: FKTN Antibody [NBP1-33383] - Sample (30 ug of whole cell lysate) A: H1299 B: Hela 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: FKTN Antibody [NBP1-33383] - Methanol-fixed HeLa, using FKTN antibody at 1:200 dilution.
Species: Hu
Applications: WB, ICC/IF
GDI1 Antibody
NBP2-99205
Western Blot: GDI1 Antibody [NBP2-99205] - Anti-GDI1 rabbit polyclonal antibody at 1:500 dilution. Lane A: NIHT3 Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti- Rabbit IgG H&L (Dylight 800) at 1/10000 dilution. Developed using the Odyssey technique. Performed under reducing conditions. Predicted band size: 51 kDa. Observed band size: 47 kDa
Immunocytochemistry/Immunofluorescence: GDI1 Antibody [NBP2-99205] - Immunofluorescence staining of GDI1 in MCF7 cells. Cells were fixed with 4% PFA, permeabilzed with 0.3% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-human GDI1 polyclonal antibody (dilution ratio 1:1000) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG secondary antibody (green).Positive staining was localized to cytoplasm.
Immunohistochemistry-Paraffin: GDI1 Antibody [NBP2-99205] - Immunochemical staining of human GDI1 in human gastric cancer with rabbit polyclonal antibody (1:2000, formalin-fixed paraffin embedded sections).
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Laminin Antibody
NB300-144
Immunohistochemistry Free-Floating: Laminin Antibody [NB300-144] - Immunohistological analysis of brain stem section stained with rabbit polyclonal Laminin Antibody [NB300-144], dilution 1:1,000 in red, and costained with chicken pAb to Myelin Basic Protein (MBP), dilution 1:5,000 in green. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 24 hours, cut to 45 uM, and free-floating sections were stained with the above antibodies. The laminin antibody is an excellent marker of basement membranes surrounding blood vessels, while the MBP antibody stains the myelin sheathes around axons.
Immunohistochemistry: Laminin Antibody [NB300-144] - MxIF analysis of mouse submandibular salivary gland morphogenesis. MxIF of a developmental TMA including embryonic stages (E14, E16, E18) and postnatal stages (P5 and P20) was performed using sequential application of directly conjugated antibodies to detect multiple markers of tissue structures and cell types on the same tissue sections. Tissue compartments. The epithelium, mesenchyme, neurons, and basement membranes was detected using antibodies directed towards E-cadherin (ECAD, red), platelet-derived growth factor (PDGFR, green), beta III tubulin (bIII, magenta), and Laminin Antibody [NB300-144] (LMN, cyan), respectively. Image collected and cropped by CiteAb from the following publication (http://bio.biologists.org/cgi/doi/10.1242/bio.20134309), licensed under a CC-BY licence.
Immunohistochemistry Free-Floating: Laminin Antibody [NB300-144] - Staining of mouse section of cortex stained with Laminin Antibody [NB300-144] (red). Blue is DAPI staining of DNA. This antibody reveals strong staining in the basement membranes of blood vessels.
(8 Reviews)
(71 Publications)
Species: Hu, Mu, Rt, ChHa, In, Ma, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
FKRP Antibody
NBP3-04945
Western Blot: FKRP Antibody [NBP3-04945] - Analysis of extracts of various cell lines, using FKRP antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Dysferlin Antibody
(JF05-54)
NBP2-66814
Western Blot: Dysferlin Antibody (JF05-54) [NBP2-66814] - Analysis of Dysferlin on human skeletal muscle lysates using anti-Dysferlin antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Dysferlin Antibody (JF05-54) [NBP2-66814] - Staining Dysferlin in SW480 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Dysferlin Antibody (JF05-54) [NBP2-66814] - Immunohistochemical analysis of paraffin-embedded human spleen tissue using anti-Dysferlin antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1/50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
gamma Sarcoglycan
Antibody
NBP1-59744
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Lane 1 mouse Heart; 2 mouse Liver (expected negative); 3 mouse Liver; 4 mouse Quadriceps; 5 mouse Triceps; 6 mouse Triceps; 7 mouse Triceps. All lanes 25ug mouse protein. Image from verified customer review.
Immunohistochemistry-Frozen: gamma Sarcoglycan Antibody [NBP1-59744] - Mouse tibialis anterior frozen sections. Image from verified customer review.
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Human Heart lysate, concentration 1.25ug/ml.
(2 Reviews)
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Laminin alpha 4
Antibody [Unconjugate
AF3837
Laminin alpha 4 Antibody [Unconjugated]
(1 Review)
(6 Publications)
Species: Mu
Applications: WB, IHC
PLEKHM1 Antibody
NBP2-38449
Immunocytochemistry/Immunofluorescence: PLEKHM1 Antibody [NBP2-38449] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human small intestine shows moderate cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human cerebral cortex shows moderate postivity in neuropil.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Choline kinase
alpha Antibody
NBP1-85630
Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P

Acetylcholinesterase/A
NBP1-31329
Western Blot: Acetylcholinesterase/ACHE Antibody [NBP1-31329] - Various tissue extracts (50 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with AChE antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NBP1-31329] - Paraformaldehyde-fixed HeLa, using AChE antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2500.
Immunohistochemistry-Frozen: Acetylcholinesterase/ACHE Antibody [NBP1-31329] - Frozen sectioned E13.5 Rat brain. Green: AChE protein stained by AChE antibody diluted at 1:250. Red: beta Tubulin 3/ TUJ1, a mature neuron marker, stained by beta Tubulin 3/ TUJ1 antibody [11710] (NBP2-43559) diluted at 1:500. Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Dystroglycan
Antibody
NBP2-14868
Western Blot: Dystroglycan Antibody [NBP2-14868] - Various tissue extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with Dystroglycan Antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Dystroglycan Antibody [NBP2-14868] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Dystroglycan protein stained by Dystroglycan antibody 38) diluted at 1:1000. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody [B-5-1-2] diluted at 1:10000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Dystroglycan Antibody [NBP2-14868] - Mouse placenta. DAG1 stained by Dystroglycan antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(2 Publications)
Species: Hu, Mu, Eq
Applications: WB, ICC/IF, IHC, IHC-P
Choline Kinase
beta [Unconjugated]
8184-CK
Choline Kinase beta [Unconjugated]
Species: Hu
Senataxin Antibody
NBP1-94712
Western Blot: Senataxin Antibody [NBP1-94712] - Input: HeLa whole cell lysate. Beads without antibody IP control. IP: IP from HeLa lysate.
Immunocytochemistry/Immunofluorescence: Senataxin Antibody [NBP1-94712] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-Senataxin at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Senataxin Antibody [NBP1-94712] - Analysis of a FFPE tissue section of human heart (transverse section) using 1:200 dilution of lot A2 of Senataxin antibody. The antibody generated a very strong staining in the cytoplasm and the nuclei of the muscle cells. No signal was found in the perimysium and endomycium area (connective tissue) of the section.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Ret Antibody
[Unconjugated]
AF482
Ret Antibody [Unconjugated]
(26 Publications)
Species: Mu
Applications: WB, IHC
PAG1 Antibody
(PAG-C1)
NB500-487
Immunohistochemistry-Paraffin: PAG1 Antibody (PAG-C1) [NB500-487] - staining (paraffin sections) of PAG/Cbp in germinal center of lymphatic follicle and in dispersed T cells in appendix tissue by monoclonal antibody PAG-C1. Positive signal in T cells.
Immunoprecipitation: PAG1 Antibody (PAG-C1) [NB500-487] - Immunoprecipitation of human Cbp/PAG from the lysate of RAJI human Burkitt lymphoma cell line. Western blot was immunostained with anti-human Cbp/PAG (MEM-255). Note: Csk-binding protein (Cbp/PAG) is a 46 kDa adaptor protein, which however migrates on SDS PAGE gels anomalously as an 80 kDa molecule. Lane 1,2: immunoprecipitation with anti-Cbp/PAG (PAG-C1) Lane 3: immunoprecipitation with anti-Cbp/PAG (polyclonal antibody).
(1 Publication)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Laminin alpha 2
Antibody (2D4) [Bioti
H00003908-M01B
Laminin alpha 2 Antibody (2D4) [Biotin]
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for Laminin alpha 2 Antibody (H00003908-M01B) (0)

There are no publications for Laminin alpha 2 Antibody (H00003908-M01B).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin alpha 2 Antibody (H00003908-M01B) (0)

There are no reviews for Laminin alpha 2 Antibody (H00003908-M01B). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Laminin alpha 2 Antibody (H00003908-M01B) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Laminin alpha 2 Products

Bioinformatics Tool for Laminin alpha 2 Antibody (H00003908-M01B)

Discover related pathways, diseases and genes to Laminin alpha 2 Antibody (H00003908-M01B). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin alpha 2 Antibody (H00003908-M01B)

Discover more about diseases related to Laminin alpha 2 Antibody (H00003908-M01B).
 

Pathways for Laminin alpha 2 Antibody (H00003908-M01B)

View related products by pathway.

PTMs for Laminin alpha 2 Antibody (H00003908-M01B)

Learn more about PTMs related to Laminin alpha 2 Antibody (H00003908-M01B).

Blogs on Laminin alpha 2

There are no specific blogs for Laminin alpha 2, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin alpha 2 Antibody (2D4) [Biotin] and receive a gift card or discount.


Bioinformatics

Gene Symbol LAMA2