Laminin alpha 2 Antibody (2D4) [Biotin]

Images

 

Product Details

Summary
Product Discontinued
View other related Laminin alpha 2 Primary Antibodies

Order Details


    • Catalog Number
      H00003908-M01B
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Laminin alpha 2 Antibody (2D4) [Biotin] Summary

Immunogen
LAMA2 (NP_000417, 3013 a.a. ~ 3122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN
Localization
Extracellular
Specificity
LAMA2 - laminin, alpha 2 (merosin, congenital muscular dystrophy)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LAMA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS (pH 7.4)
Preservative
0.05% Sodium Azide
Purity
IgG purified

Alternate Names for Laminin alpha 2 Antibody (2D4) [Biotin]

  • LAMA2
  • Laminin alpha 2
  • Laminin M chain
  • laminin subunit alpha-2
  • laminin, alpha 2
  • Laminin-12 subunit alpha
  • Laminin-2 subunit alpha
  • LAMM
  • LAMMLaminin-4 subunit alpha
  • Merosin heavy chain
  • Merosin

Background

Laminin, an extracellular protein, is a major component of the basement membrane. It is thought to mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. It is composed of three subunits, alpha, beta, and gamma, which are bound to each other by disulfide bonds into a cross-shaped molecule. This gene encodes the alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Mutations in this gene have been identified as the cause of congenital merosin-deficient muscular dystrophy. Two transcript variants encoding different proteins have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-33383
Species: Hu
Applications: WB, ICC/IF
NBP2-99205
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-144
Species: Hu, Mu, Rt, ChHa, In, Ma, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP3-04945
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-66814
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
AF3837
Species: Mu
Applications: WB, IHC
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31329
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14868
Species: Hu, Mu, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94712
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003908-M01B
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for Laminin alpha 2 Antibody (H00003908-M01B) (0)

There are no publications for Laminin alpha 2 Antibody (H00003908-M01B).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Laminin alpha 2 Antibody (H00003908-M01B) (0)

There are no reviews for Laminin alpha 2 Antibody (H00003908-M01B). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Laminin alpha 2 Antibody (H00003908-M01B) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Laminin alpha 2 Products

Bioinformatics Tool for Laminin alpha 2 Antibody (H00003908-M01B)

Discover related pathways, diseases and genes to Laminin alpha 2 Antibody (H00003908-M01B). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Laminin alpha 2 Antibody (H00003908-M01B)

Discover more about diseases related to Laminin alpha 2 Antibody (H00003908-M01B).
 

Pathways for Laminin alpha 2 Antibody (H00003908-M01B)

View related products by pathway.

PTMs for Laminin alpha 2 Antibody (H00003908-M01B)

Learn more about PTMs related to Laminin alpha 2 Antibody (H00003908-M01B).

Blogs on Laminin alpha 2

There are no specific blogs for Laminin alpha 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Laminin alpha 2 Antibody (2D4) [Biotin] and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMA2