Lamin B1 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Analysis in human lymph node and skeletal muscle tissue. Corresponding RNA-seq data are presented for the same tissues.
Western Blot: Lamin B1 Antibody [NBP2-48966] - Analysis in human cell line RH-30.
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody [NBP2-48966] - Staining of human cell line MCF7 shows localization to nuclear membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human skeletal muscle shows moderate to strong positivity in nuclear membrane in myocytes.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human lymph node shows moderate to strong positivity in nuclear membrane in non-germinal center cells.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human skin shows moderate to strong positivity in nuclear membrane in keratinocytes.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human small intestine shows moderate to strong positivity in nuclear membrane in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Lamin B1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMNB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Lamin B1 Recombinant Protein Antigen (NBP2-48966PEP)
Publications
Read Publications using
NBP2-48966 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Lamin B1 Antibody - BSA Free

  • ADLD
  • Lamin B1
  • lamin-B1
  • LMN
  • LMN2
  • LMNB
  • LMNB1
  • MGC111419

Background

Nuclear lamins form a network of intermediate-type filaments at the nucleoplasmic site of the nuclear membrane.Two main subtypes of nuclear lamins can be distinguished, i.e. A-type lamins and B-type lamins. The A-type lamins comprise a set of three proteins arising from the same gene by alternative splicing, i.e. lamin A, lamin C and lamin Adel 10, while the B-type lamins include two proteins arising from two distinct genes, i.e. lamin B1 and lamin B2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74451
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1436
Species: Mu
Applications: WB
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-44634
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
NBP2-59947
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-87692
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-62573
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for Lamin B1 Antibody (NBP2-48966)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IF/IHC.


Filter By Application
ICC/IF
(1)
IF/IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Lamin B1 Antibody (NBP2-48966) (0)

There are no reviews for Lamin B1 Antibody (NBP2-48966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Lamin B1 Antibody (NBP2-48966). (Showing 1 - 1 of 1 FAQs).

  1. I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?
    • We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.

Secondary Antibodies

 

Isotype Controls

Additional Lamin B1 Products

Research Areas for Lamin B1 Antibody (NBP2-48966)

Find related products by research area.

Blogs on Lamin B1

There are no specific blogs for Lamin B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lamin B1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol LMNB1