Lamin B1 Antibody

Images

 
Western Blot: Lamin B1 Antibody [NBP2-48966] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: ...read more
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody [NBP2-48966] - Staining of human cell line MCF7 shows localization to nuclear membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human skeletal muscle shows moderate to strong positivity in nuclear membrane in myocytes.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Analysis in human lymph node and skeletal muscle tissue. Corresponding RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human lymph node shows moderate to strong positivity in nuclear membrane in non-germinal center cells.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human skin shows moderate to strong positivity in nuclear membrane in keratinocytes.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human small intestine shows moderate to strong positivity in nuclear membrane in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Lamin B1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK
Specificity
Specificity of human Lamin B1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMNB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
Lamin B1 Lysate (NBP2-64874)
Control Peptide
Lamin B1 Recombinant Protein Antigen (NBP2-48966PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lamin B1 Antibody

  • ADLD
  • Lamin B1
  • lamin-B1
  • LMN
  • LMN2
  • LMNB
  • LMNB1
  • MGC111419

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-43834
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF1436
Species: Mu
Applications: WB
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-88927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-50051
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75696
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Lamin B1 Antibody (NBP2-48966) (0)

There are no publications for Lamin B1 Antibody (NBP2-48966).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lamin B1 Antibody (NBP2-48966) (0)

There are no reviews for Lamin B1 Antibody (NBP2-48966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Lamin B1 Antibody (NBP2-48966). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?
    • We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Lamin B1 Antibody (NBP2-48966)

Discover related pathways, diseases and genes to Lamin B1 Antibody (NBP2-48966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lamin B1 Antibody (NBP2-48966)

Discover more about diseases related to Lamin B1 Antibody (NBP2-48966).
 

Pathways for Lamin B1 Antibody (NBP2-48966)

View related products by pathway.

PTMs for Lamin B1 Antibody (NBP2-48966)

Learn more about PTMs related to Lamin B1 Antibody (NBP2-48966).
 

Research Areas for Lamin B1 Antibody (NBP2-48966)

Find related products by research area.

Blogs on Lamin B1

There are no specific blogs for Lamin B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lamin B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMNB1