Orthogonal Strategies: Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Analysis in human lymph node and skeletal muscle tissue. Corresponding RNA-seq data are presented for the same tissues.
Western Blot: Lamin B1 Antibody [NBP2-48966] - Analysis in human cell line RH-30.
Immunocytochemistry/ Immunofluorescence: Lamin B1 Antibody [NBP2-48966] - Staining of human cell line MCF7 shows localization to nuclear membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human skeletal muscle shows moderate to strong positivity in nuclear membrane in myocytes.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human lymph node shows moderate to strong positivity in nuclear membrane in non-germinal center cells.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human skin shows moderate to strong positivity in nuclear membrane in keratinocytes.
Immunohistochemistry-Paraffin: Lamin B1 Antibody [NBP2-48966] - Staining of human small intestine shows moderate to strong positivity in nuclear membrane in glandular cells.
Novus Biologicals Rabbit Lamin B1 Antibody - BSA Free (NBP2-48966) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Lamin B1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMNB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Lamin B1 Antibody - BSA Free
ADLD
Lamin B1
lamin-B1
LMN
LMN2
LMNB
LMNB1
MGC111419
Background
Nuclear lamins form a network of intermediate-type filaments at the nucleoplasmic site of the nuclear membrane.Two main subtypes of nuclear lamins can be distinguished, i.e. A-type lamins and B-type lamins. The A-type lamins comprise a set of three proteins arising from the same gene by alternative splicing, i.e. lamin A, lamin C and lamin Adel 10, while the B-type lamins include two proteins arising from two distinct genes, i.e. lamin B1 and lamin B2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for Lamin B1 Antibody (NBP2-48966). (Showing 1 - 1 of 1 FAQs).
I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?
We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Lamin B1 Antibody - BSA Free and receive a gift card or discount.