Recombinant Human Lactalbumin Alpha Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Lactalbumin Alpha Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 33 - 142 of Human LALBA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
LALBA
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Lactalbumin Alpha Protein

  • alpha-lactalbumin
  • lactalbumin, alpha-
  • Lactose synthase B protein
  • Lysozyme-like protein 7
  • LYZL7
  • MGC138521
  • MGC138523

Background

LALBA - lactalbumin, alpha-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-2720
Species: Hu
Applications: WB, IHC
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP1-88654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-648
Species: Bv
Applications: WB, ELISA, IP
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
H00003906-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Lactalbumin Alpha Partial Recombinant Protein (H00003906-Q01) (0)

There are no publications for Lactalbumin Alpha Partial Recombinant Protein (H00003906-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lactalbumin Alpha Partial Recombinant Protein (H00003906-Q01) (0)

There are no reviews for Lactalbumin Alpha Partial Recombinant Protein (H00003906-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lactalbumin Alpha Partial Recombinant Protein (H00003906-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Lactalbumin Alpha Products

Bioinformatics Tool for Lactalbumin Alpha Partial Recombinant Protein (H00003906-Q01)

Discover related pathways, diseases and genes to Lactalbumin Alpha Partial Recombinant Protein (H00003906-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lactalbumin Alpha Partial Recombinant Protein (H00003906-Q01)

Discover more about diseases related to Lactalbumin Alpha Partial Recombinant Protein (H00003906-Q01).
 

Pathways for Lactalbumin Alpha Partial Recombinant Protein (H00003906-Q01)

View related products by pathway.

Research Areas for Lactalbumin Alpha Partial Recombinant Protein (H00003906-Q01)

Find related products by research area.

Blogs on Lactalbumin Alpha

There are no specific blogs for Lactalbumin Alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Lactalbumin Alpha Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LALBA