L3MBTL4 Antibody - BSA Free

Immunohistochemistry: L3MBTL4 Antibody [NBP2-39018] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

L3MBTL4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit L3MBTL4 Antibody - BSA Free (NBP2-39018) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IGWCDVTGHPLEVPQRTNDLKILPGQAVCPTPGCRGIGHIRGPRYSGHHSAFGCPYSDMNLKKEATLHDRLREQTQANLESD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: L3MBTL4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  L3MBTL4 Protein (NBP2-39018PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for L3MBTL4 Antibody - BSA Free

• FLJ35936
• H-l(3)mbt-like protein 4
• HsT1031
• l(3)mbt-like 4 (Drosophila)
• L(3)mbt-like protein 4
• lethal(3)malignant brain tumor-like protein 4

Background

L3MBTL4, also known as Lethal(3)malignant brain tumor-like protein 4, has a 623 amino acid isoform that is 71 kDa and a short 534 amino acid that is 61 kDa, nucleus located; belongs to Putative Polycomb group (PcG), and maintains the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. There has been research revolving around the L3MBTL4 protein involvement in breast cancer. This protein is involved in transcription, DNA-dependent; regulation of transcription, DNA-dependent; and chromatin modification pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: L3MBTL4
• Uniprot:
  • Q8NA19(Human)