![Immunocytochemistry/Immunofluorescence: CASKIN2 Antibody [NBP2-62674] - Staining of human cell line A-431 shows localization to nuclear bodies, plasma membrane & actin filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CASKIN2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-62674-img0004.jpg "Immunocytochemistry/Immunofluorescence: CASKIN2 Antibody [NBP2-62674] - Staining of human cell line A-431 shows localization to nuclear bodies, plasma membrane & actin filaments. Antibody staining is shown in green.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: APWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CASKIN2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
| Publication using NBP2-62674 | Applications | Species |
|---|---|---|
| Li N, Wang J, Wang X et al. Icariin exerts a protective effect against d-galactose induced premature ovarian failure via promoting DNA damage repair Biomed. Pharmacother. 2019-07-19 [PMID: 31330441] (ELISA, Mouse) | ELISA | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for CASKIN2 Antibody (NBP2-62674)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CASKIN2 |
![Immunohistochemistry-Paraffin: CASKIN2 Antibody [NBP2-62674] - Staining of human tonsil shows low expression as expected.](http://images.novusbio.com/fullsize/CASKIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-62674-img0003.jpg "Immunohistochemistry-Paraffin: CASKIN2 Antibody [NBP2-62674] - Staining of human tonsil shows low expression as expected.")
![Immunohistochemistry-Paraffin: CASKIN2 Antibody [NBP2-62674] - Analysis in human spleen and tonsil tissues using Anti-CASKIN2 antibody. Corresponding CASKIN2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CASKIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-62674-img0001.jpg "Immunohistochemistry-Paraffin: CASKIN2 Antibody [NBP2-62674] - Analysis in human spleen and tonsil tissues using Anti-CASKIN2 antibody. Corresponding CASKIN2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CASKIN2 Antibody [NBP2-62674] - Staining of human spleen shows high expression.](http://images.novusbio.com/fullsize/CASKIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-62674-img0002.jpg "Immunohistochemistry-Paraffin: CASKIN2 Antibody [NBP2-62674] - Staining of human spleen shows high expression.")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![N/A LBP [Biotin]](https://images.novusbio.com/images2/DATA_LBP_DY87005_ELISA_2551.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")