CASKIN2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CASKIN2 Antibody [NBP2-62674] - Staining of human cell line A-431 shows localization to nuclear bodies, plasma membrane & actin filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CASKIN2 Antibody [NBP2-62674] - Staining of human tonsil shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CASKIN2 Antibody [NBP2-62674] - Analysis in human spleen and tonsil tissues using Anti-CASKIN2 antibody. Corresponding CASKIN2 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: CASKIN2 Antibody [NBP2-62674] - Staining of human spleen shows high expression.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ELISA, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CASKIN2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: APWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CASKIN2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in ELISA reported in scientific literature (PMID: 31330441).
Control Peptide
CASKIN2 Recombinant Protein Antigen (NBP2-62674PEP)
Publications
Read Publication using
NBP2-62674 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31330441). Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for CASKIN2 Antibody

  • ANKS5B
  • CASK interacting protein 2
  • caskin-2
  • FLJ21609
  • KIAA1139

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30414
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-89107
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15009
Species: Hu, Mu
Applications: WB
NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84915
Species: Hu
Applications: WB, IHC, IHC-P
AF4524
Species: Rt
Applications: WB
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP2-76922
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-47316
Species: Hu
Applications: WB (-), IHC, IP
LBP
6445-LP/CF
Species: Hu
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP2-58972
Species: Hu
Applications: WB, ICC/IF
NBP2-58781
Species: Hu
Applications: IHC, IHC-P
NB100-61625
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-62674
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P

Publications for CASKIN2 Antibody (NBP2-62674)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for CASKIN2 Antibody (NBP2-62674) (0)

There are no reviews for CASKIN2 Antibody (NBP2-62674). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CASKIN2 Antibody (NBP2-62674) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CASKIN2 Products

Bioinformatics Tool for CASKIN2 Antibody (NBP2-62674)

Discover related pathways, diseases and genes to CASKIN2 Antibody (NBP2-62674). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CASKIN2

There are no specific blogs for CASKIN2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CASKIN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CASKIN2