Kynureninase Antibody (1G2)

Images

 
Western Blot: Kynureninase Antibody (1G2) [H00008942-M02] - Analysis of KYNU expression in transfected 293T cell line by KYNU monoclonal antibody (M02), clone 1G2.Lane 1: KYNU transfected lysate (Predicted MW: 34.6 ...read more
Sandwich ELISA: Kynureninase Antibody (1G2) [H00008942-M02] - Detection limit for recombinant GST tagged KYNU is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Kynureninase Antibody (1G2) Summary

Immunogen
KYNU (NP_003928, 2 a.a. - 108 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRP
Specificity
KYNU (1G2)
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
KYNU
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kynureninase Antibody (1G2)

  • EC 3.7.1.3
  • KYNU
  • kynureninase (L-kynurenine hydrolase)
  • Kynureninase
  • L-kynurenine hydrolase

Background

Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45995
Species: Hu
Applications: WB, IHC
NBP2-29936
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP1-85892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87702
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86108
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
H00008942-M02
Species: Hu
Applications: WB, ELISA

Publications for Kynureninase Antibody (H00008942-M02) (0)

There are no publications for Kynureninase Antibody (H00008942-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kynureninase Antibody (H00008942-M02) (0)

There are no reviews for Kynureninase Antibody (H00008942-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kynureninase Antibody (H00008942-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kynureninase Products

Bioinformatics Tool for Kynureninase Antibody (H00008942-M02)

Discover related pathways, diseases and genes to Kynureninase Antibody (H00008942-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kynureninase Antibody (H00008942-M02)

Discover more about diseases related to Kynureninase Antibody (H00008942-M02).
 

Pathways for Kynureninase Antibody (H00008942-M02)

View related products by pathway.

PTMs for Kynureninase Antibody (H00008942-M02)

Learn more about PTMs related to Kynureninase Antibody (H00008942-M02).

Blogs on Kynureninase

There are no specific blogs for Kynureninase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kynureninase Antibody (1G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol KYNU
Entrez
OMIM
Uniprot