Kv4.3 Antibody

Images

 
Immunohistochemistry-Paraffin: Kv4.3 Antibody [NBP1-82864] - Staining of human cerebellum shows cytoplasmic positivity in cells in granular layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv4.3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCND3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kv4.3 Protein (NBP1-82864PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv4.3 Antibody

  • KCND3L
  • KCND3S
  • KSHIVB
  • Kv4.3
  • MGC142035
  • MGC142037
  • potassium ionic channel Kv4.3
  • potassium voltage-gated channel subfamily D member 3
  • potassium voltage-gated channel, Shal-related subfamily, member 3
  • sha1-related potassium channel Kv4.3
  • voltage-gated K+ channel
  • voltage-gated potassium channel Kv4.3
  • Voltage-gated potassium channel subunit Kv4.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81336
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
NBL1-12154
Species: Hu
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
H00003736-B01P
Species: Hu
Applications: WB
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-19020
Species: Hu, Mu, Rt, Po, Bv
Applications: WB
NLS7412
Species: Hu, Mu, Rt, Po, Bt, Bv, Eq, Mk, Pm
Applications: IHC, IHC-P
NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP2-30049
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-82864
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Kv4.3 Antibody (NBP1-82864) (0)

There are no publications for Kv4.3 Antibody (NBP1-82864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv4.3 Antibody (NBP1-82864) (0)

There are no reviews for Kv4.3 Antibody (NBP1-82864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kv4.3 Antibody (NBP1-82864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv4.3 Products

Bioinformatics Tool for Kv4.3 Antibody (NBP1-82864)

Discover related pathways, diseases and genes to Kv4.3 Antibody (NBP1-82864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv4.3 Antibody (NBP1-82864)

Discover more about diseases related to Kv4.3 Antibody (NBP1-82864).
 

Pathways for Kv4.3 Antibody (NBP1-82864)

View related products by pathway.

PTMs for Kv4.3 Antibody (NBP1-82864)

Learn more about PTMs related to Kv4.3 Antibody (NBP1-82864).

Blogs on Kv4.3

There are no specific blogs for Kv4.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv4.3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCND3