Kv4.2 Antibody

Images

 
Immunohistochemistry-Paraffin: Kv4.2 Antibody [NBP1-87708] - Staining of human cerebellum shows strong cytoplasmic positivity in cells of granular layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv4.2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCND2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kv4.2 Protein (NBP1-87708PEP)
Publications
Read Publication using NBP1-87708.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24037343)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv4.2 Antibody

  • potassium voltage-gated channel, Shal-related subfamily, member 2
  • RK5
  • voltage-gated potassium channel Kv4.2
  • voltage-sensitive potassium channel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19315
Species: Hu
Applications: WB
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP1-81336
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
NBP2-19020
Species: Hu, Mu, Rt, Po, Bv
Applications: WB
NBP2-30049
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
H00003736-B01P
Species: Hu
Applications: WB
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47481
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-12154
Species: Hu
H00080333-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00003738-M01
Species: Hu
Applications: WB, ELISA
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP1-87708
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Kv4.2 Antibody (NBP1-87708)(1)

Reviews for Kv4.2 Antibody (NBP1-87708) (0)

There are no reviews for Kv4.2 Antibody (NBP1-87708). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kv4.2 Antibody (NBP1-87708) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv4.2 Products

Bioinformatics Tool for Kv4.2 Antibody (NBP1-87708)

Discover related pathways, diseases and genes to Kv4.2 Antibody (NBP1-87708). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv4.2 Antibody (NBP1-87708)

Discover more about diseases related to Kv4.2 Antibody (NBP1-87708).
 

Pathways for Kv4.2 Antibody (NBP1-87708)

View related products by pathway.

PTMs for Kv4.2 Antibody (NBP1-87708)

Learn more about PTMs related to Kv4.2 Antibody (NBP1-87708).
 

Research Areas for Kv4.2 Antibody (NBP1-87708)

Find related products by research area.

Blogs on Kv4.2

There are no specific blogs for Kv4.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv4.2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCND2